KEGG   Astyanax mexicanus (Mexican tetra): 103026958
Entry
103026958         CDS       T05042                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00220  Arginine biosynthesis
amex00330  Arginine and proline metabolism
amex01100  Metabolic pathways
amex04020  Calcium signaling pathway
amex04146  Peroxisome
amex04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103026958
   00330 Arginine and proline metabolism
    103026958
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103026958
   04020 Calcium signaling pathway
    103026958
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103026958
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103026958
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 CENP-P
Other DBs
NCBI-GeneID: 103026958
NCBI-ProteinID: XP_022536246
Ensembl: ENSAMXG00000011861
LinkDB
Position
1
AA seq 1075 aa
MGKTIVENELPQAKANTKVSEKKVSRCPMAMQMKNFQNGSSHQDTLYHRAIKNQLCKPKV
CEGSVMNPKTLIRSPANTPPGPNELLIQAIDFINQYYKSFKTSKIEEHLARVDEVAQEID
ATGTYQLTTEELAFGAKQAWRNAPRCIGRIQWANLQLFDARHCKTAKEMFQFMCSHLKFA
TNGGNLRSAITVFPQRTDGEHDFRVWNGQLIKYAGYQMEDGSVVGDPASVEFTELCIQLG
WTPKYGLFDVLPLVLQANGEDPELFEIPPELILEVEMEHPHYEWFKDLNLRWYALPAVAN
MLMEIGGLEFTACPFNGWYMGTEIGVRDFCDPQRYNILEKVGCYMGLETQKLSSLWKDEA
LVAINVAVIHSFQKNKVTITDHHSAAESFMKHMETEVRLRGGCPADWIWLVPPMSGSLTP
VFHQEMISYILSPFFYYQTDPWLTHVWKDEEKGLKKRKRISFGALTKAVVFSQILMQKAL
ENRVPCTILYATETGKSQTFAKKLKSMLSCAFNPRLLCMEDYRFGDLEKERLLIVVTSTF
GNGESPGNGETFQKKLMGKKQLKNNLRYCVFGLGSRMYPQFCAFAHAVDDKLAELGAKCV
TPIGEGDELNGQDEAFSAWACTAFKAVCKEFGIEGQLSGAERLTDSWDPQKIRVQPDSST
LDCISALSALHSKTVFPMKLKRRKNLQSSQSRRSTILVELEVHGAKDVLNYAPGDHVGVF
PENSPELVTGILKHIPSVPPTNQSLHLEYQANSGGVGWQKDERLPACSLTQALTYLLDIT
TPPSQGLLRKLSQVSKKEDDRQRLLALASDFKSYSEWKEFRKPNFLEVLEEFPSLEVSAA
FVLSQLPLMKPRLYSLSSSPDLHPNELHLTVSVVNYRTQDGKGPLHHGVCSTWLNTLKDG
HTVPCFIHGSSGFHLPPDPTTPTILIGAGSGIAPFRSFWQQRYHDKEKKGLKESPMMLVF
GCRDSDTDHLYKEETYEMRENGTLKSITPAYSRQPGHPKVYVQDVLKKQLSEEVWQALQK
AGHVYVCGGMNMAREVAHTIQDIVAGQLGVPFSEAGGYLERLKAEKRYHEDIFGA
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgggaaagacgattgttgagaatgagctgcctcaagcaaaggctaatactaaggtaagt
gagaagaaggtcagtcgctgcccgatggcaatgcaaatgaagaactttcagaatgggtcc
agccaccaagacacactttatcacagagccatcaagaatcagctctgcaaacccaaagtg
tgtgaaggctcagtcatgaacccaaagactctaattcgttcccctgccaacaccccacca
ggacctaatgagcttctcattcaggccattgacttcatcaaccagtactataagtccttc
aaaacgtctaaaattgaggagcacttggcccgtgttgatgaggtggcccaggaaatcgat
gccacaggaacttatcagctcaccactgaagagctggcatttggagccaaacaggcatgg
aggaacgcgccaaggtgcattggtcggattcagtgggctaatttacagctgtttgatgct
cgccattgcaagactgccaaggaaatgttccagttcatgtgctctcatctgaaatttgcc
acaaatggaggaaatttaagatcggctatcactgtgtttccgcaaagaacagatggggag
cacgatttccgtgtttggaacggtcagctaataaaatatgccggctaccagatggaggat
ggtagtgtggttggggatcctgccagtgtggaattcacggagctttgtatccagcttgga
tggacaccaaaatatgggctctttgatgtgctgccactggtcctgcaagctaatggagaa
gatcctgaactgtttgaaattccgccagaactgatattggaggttgaaatggagcatcct
cattacgagtggttcaaagatctgaacctccggtggtacgccctgcccgcagtggccaac
atgctgatggagattggtggtcttgagtttacagcttgccccttcaatggctggtacatg
ggcactgagattggagtgagggacttctgcgatcctcagcgctacaacattctggagaag
gttggctgttatatgggcttggaaactcagaagttgtcctcactgtggaaggatgaagct
ctggttgccattaatgttgctgtgattcatagttttcagaaaaataaggtgaccatcacc
gatcaccactctgcagccgagtccttcatgaagcacatggagactgaagtgcgtctgcga
ggagggtgtcctgcagactggatctggctggtgccgcccatgtctggctctcttacccca
gtgttccaccaggagatgatcagctacatcctctcccctttcttctactaccagactgat
ccctggttaacacatgtctggaaagatgaggagaaaggactgaagaagcgaaaaagaatt
agctttggagcactgacaaaggctgtggtcttttctcaaattctcatgcaaaaagcttta
gagaacagagtcccttgcaccattctatatgcgactgaaactggaaaatctcagactttt
gccaaaaagcttaagtctatgctgagctgtgccttcaatcccaggctgctctgcatggag
gactacagatttggtgatcttgagaaagaacgccttctgatagtggtgaccagcaccttt
ggcaatggggaatctccaggaaatggagagactttccagaagaagctcatgggtaagaaa
caactcaaaaacaacctcaggtactgtgttttcggcctgggctctcggatgtacccgcag
ttctgtgcgtttgctcatgctgtggatgataagcttgcagagctgggagccaagtgtgtg
acccccataggagagggtgacgagctgaacggccaggatgaggcgttctctgcctgggcc
tgcactgcttttaaggctgtgtgtaaggagtttggcattgagggtcaactgtcaggagct
gagcgtctaacagacagctgggaccctcagaagatcagagttcagcctgacagctccacc
ttggattgcatttctgctctctcagccctccactctaagactgtgttcccaatgaagctg
aaaaggaggaagaacctgcagagctctcagtcaagacgctctacaatcctggtggagctg
gaggtacatggagcaaaggatgtgctaaattatgctcccggagaccatgtgggcgttttc
ccagagaactcacctgagctggtgactggaatcctgaagcacatccccagcgtgcctccc
accaatcagagcctccaccttgagtaccaagcaaattctggaggtgtgggatggcagaag
gatgaacgtctcccagcatgctccctgacccaggctcttacataccttctggatatcacc
actccaccttcacaaggcctcctgcgcaaactctcacaagtgtccaagaaggaagatgac
cgtcagcggctgctggctctagcttcggactttaagagttactcagaatggaaggaattc
cgtaagcccaactttttggaggttctggaggagttcccgtcgctggaggtctctgcagcc
ttcgtcctcagccagctgcccctgatgaagccccgcctctactccctcagttcttctcct
gaccttcaccctaatgagcttcatctcactgtgtctgtggtcaactatcgaacccaagat
ggaaagggtcctcttcatcatggagtctgcagcacatggctcaacactcttaaagatgga
catacggttccatgctttattcatggatccagtgggttccaccttccaccagaccctacc
acccctactatcctgattggagctggcagtggcatcgcccccttccgcagcttctggcaa
cagcgctaccatgacaaggaaaagaaaggtctgaaagagagtccaatgatgctggtgttt
ggctgccgtgattcagacacagatcatctgtataaagaagaaacttatgagatgagagaa
aacggtactctgaagagcatcactccagcgtactctcgccagcctggacaccccaaggtg
tatgttcaggatgtcctgaagaagcagctcagtgaggaggtctggcaggcccttcagaaa
gctggtcatgtgtacgtctgtgggggcatgaacatggcccgggaagtggcacacaccata
caggatattgtggccggtcagctgggcgtacctttctcagaggctgggggatacctggaa
cgattaaaggctgagaaaagataccatgaagacatctttggagcatag

DBGET integrated database retrieval system