KEGG   Astyanax mexicanus (Mexican tetra): 103027052
Entry
103027052         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103027052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103027052
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:amex03310]
    103027052
Transcription factors [BR:amex03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103027052
Nuclear receptors [BR:amex03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103027052
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 E_Pc_C
Other DBs
NCBI-GeneID: 103027052
NCBI-ProteinID: XP_022527760
LinkDB
Position
8
AA seq 779 aa
MDKGGLKEXVMKRDERLITLNYSDGPAEGVLQNGTRSTMSIASTSLVPPPSPLMQPVTGD
LLNGLSSSPTPEELTTPATLDLYMEDLDMKTVGRDPRAQQAFQQQSSLGYCGVGDSLSRL
EASIADLSSSSPSVDSLIGGVDPSLFTLKHEDFSPMGKGDIDVEPDPFGPIGKDMDSSTP
KLFSENTLDLLNDFEIETSPDFYVVDEDFPPLGEDSLLGVIGPERDLKPAASVSDINGTS
NSSNNISSNNVGSNSATSCASTGLTTASAPLVVKVEKDPVLQLCTQGVIKQENTGGRSFC
QMAGNELSSPLTAPSISICGVSTSSGQSYRFGSPAATSTISIQQKDQKPIFNVYTPQPLV
GDGWGRSLGIQQRPGDGFASNQSFTTSYASGTNRPEATSTGTGKSSGATHKICLVCSDEA
SGCHYGVLTCGSCKVFFKRAVEGWRSRQNTDGQHNYLCAGRNDCIIDKIRRKNCPACRFR
KCLMAGMNLEARKVKKLKGLKGVQQPNAADLSPAPVQEVRALVPKAMPQLVPTMLSLLKA
IEPETIYAGYDSTLTDTSTRLMTTLNRLGGRQFVSAVKWAKTLPGFRNLHLDDQMTLLQS
SWLFLMSFGLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMGDQCAQMLKISNEFVRLQV
SNEEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVRREENSSQNWQRFYQL
TKLLDSMHDMVGGLMNFCFYTFVNKSLSVEFPEMLAEIISNQLPKIKAGSVKPLLFHQK
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggacaaaggaggtctaaaggagnncgtcatgaagagagatgagcgtctaatcaccctg
aattacagcgacggcccagctgagggagttttacaaaacggaacacgcagcactatgtct
atcgcctccacttctctagttcctccacccagccccttgatgcagcctgtgactggggac
ctcctaaatggactcagcagctcccccactccggaggagctcaccacaccggccacactg
gacctctatatggaagatctggacatgaaaacagtcgggagggacccgagagcccagcag
gccttccagcagcagtcgtcgctgggctactgcggtgtgggggacagcttgtcacggctg
gaggccagcattgcagatctcagcagctcctctccgtctgtggactctttaatcggagga
gtggatcccagcctcttcacactgaaacatgaggacttctcacccatgggcaaaggggat
atagatgtggagccagatccgttcgggcctatcggaaaagacatggactcgagtactccg
aaattattcagcgagaacaccctggaccttctgaatgattttgagattgaaacatcacca
gatttctatgtggtagatgaagatttccccccattgggtgaggactctctactgggagtc
attggcccagaaagggacttgaagcctgcagcttctgtgagtgacatcaatggcactagc
aacagcagcaacaacatcagcagcaacaacgtcgggagtaacagtgcaaccagctgtgct
tctaccggtctgactaccgccagcgctccccttgtggtgaaggtggagaaggatccagtg
ctccagctctgcactcaaggagtgatcaagcaggagaacaccggtggacggagcttctgt
caaatggcggggaacgaactgtcgagccctcttactgccccatcgatctccatctgtggc
gtcagcacctccagtgggcagagctaccgcttcggaagtcctgccgccaccagcaccatc
agcatccagcagaaagatcagaagcccatttttaatgtttataccccacagccccttgtt
ggggatggctggggaaggagtcttgggatacagcaaaggcctggggatggcttcgccagc
aaccagagctttacaaccagctatgccagcggcacaaacaggcctgaggctacatccact
ggcacagggaaatccagtggcgccacacacaaaatctgcctggtgtgttcagacgaggcg
tcgggctgccactacggtgttctgacctgcggcagctgcaaggtcttcttcaaaagagct
gtggaaggatggcgatcgagacaaaacacagatgggcaacacaactacctgtgtgctggg
aggaatgactgcatcatcgataagatccgccggaagaactgtccggcctgccgcttccgc
aagtgtctcatggccgggatgaacctagaggcacgcaaagtcaagaaactaaagggctta
aagggtgtgcagcagccaaacgcagctgacctgagcccagctccagtgcaggaggtgcgg
gcgctggtgcccaaggccatgccacagctcgtgcccaccatgctgtccctgctcaaagcc
atcgagccagagaccatttatgctggatacgacagcacactgaccgacacatccactcgc
ctaatgaccaccctcaacaggctgggcggccgccagttcgtctccgcagtcaagtgggcc
aaaactctgccaggttttaggaatcttcacctggatgatcagatgactctactgcagtcc
tcctggctcttcctcatgtccttcggcctgggctggaggtcctaccagcagtgcaatgga
aacatgctctgctttgctccagatctggtgatcaatgaggagaggatgaaactgccctac
atgggtgatcagtgtgcacagatgctgaagatctccaatgagtttgtcaggctgcaggtg
tccaatgaggaatacctgtgcatgaaggtcctgctgctgctcagcaccgtgccaaaggac
ggtctgaagagccaggctgtgttcgatgagatcaggatgtcctacattaaagaactgggc
aaagccattgtcaggagagaggagaactccagccagaactggcagcgattttaccagctc
actaagctactcgactccatgcacgatatggtgggtggactgatgaatttctgcttctac
acatttgtgaacaagtctctgagcgtggagttccccgagatgctcgccgaaatcatcagc
aaccaattaccaaaaataaaagccgggagtgtcaaaccgctgctctttcaccagaaatga

DBGET integrated database retrieval system