KEGG   Astyanax mexicanus (Mexican tetra): 103027348
Entry
103027348         CDS       T05042                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103027348
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103027348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amex04052]
    103027348
   00536 Glycosaminoglycan binding proteins [BR:amex00536]
    103027348
Cytokines and growth factors [BR:amex04052]
 Growth factors
  Growth factors (RTK binding)
   103027348
Glycosaminoglycan binding proteins [BR:amex00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103027348
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103027348
NCBI-ProteinID: XP_007258640
Ensembl: ENSAMXG00000011642
UniProt: A0A3B1IWA1
LinkDB
Position
8
AA seq 146 aa
MEASGGQAGVQDYRRRTRLHCLNGGYHLLILPDGAVQGSREEEHRYSVLRIKAVSPGVVV
IEGVEAGRFLSMSEDGTLYGSPSVTDESYFLERIEENHYNTYQSQKYGPNWYVGLKKNGN
PKNGSRTHIGQKAIFFLPLQLDQMKD
NT seq 441 nt   +upstreamnt  +downstreamnt
atggaggcgagcggcgggcaggccggggtgcaggactacaggaggcggacccgcctgcac
tgcctgaacggcggataccatctgctcatcctgccggacggagcggtacagggcagccgg
gaggaggagcacagatacagtgtattgaggataaaagcagtaagtcctggagtggtggtg
attgagggagtagaagcaggacgtttcctcagcatgagtgaggatggaactctgtacggc
tcaccgtcagtaacagatgaaagctactttctggagagaatagaggagaaccactacaac
acataccagtctcaaaagtacggccccaactggtacgttggtttaaaaaagaacggaaac
cccaaaaatggctcgaggacccacatcggacagaaagccattttcttccttcctctacag
ctggatcaaatgaaagactga

DBGET integrated database retrieval system