KEGG   Astyanax mexicanus (Mexican tetra): 103027936
Entry
103027936         CDS       T05042                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00230  Purine metabolism
amex01100  Metabolic pathways
amex04020  Calcium signaling pathway
amex04114  Oocyte meiosis
amex04261  Adrenergic signaling in cardiomyocytes
amex04270  Vascular smooth muscle contraction
amex04371  Apelin signaling pathway
amex04540  Gap junction
amex04912  GnRH signaling pathway
amex04914  Progesterone-mediated oocyte maturation
amex04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103027936 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103027936 (adcy3)
   04020 Calcium signaling pathway
    103027936 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103027936 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103027936 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103027936 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    103027936 (adcy3)
   04916 Melanogenesis
    103027936 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103027936 (adcy3)
   04270 Vascular smooth muscle contraction
    103027936 (adcy3)
Enzymes [BR:amex01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103027936 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 Calmodulin_bind
Other DBs
NCBI-GeneID: 103027936
NCBI-ProteinID: XP_007251869
Ensembl: ENSAMXG00000020337
LinkDB
Position
10
AA seq 1120 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMLLTFAPD
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCTVVYTSDKLASVAVASVGLAADVL
LYLLCRYGLLPERISRRLVPYALWVLIAAQIFCYLGLNFARFHQASDTVGWQAFFCFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANILIYLCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEAS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQNTLECLHGEFDVEPGNGGDRCE
YLKERGIETYLVVVPKGPISKNGINGVKLSVTSSNGNSPLLINTTECNGSVHTACTTPEE
PEELDARVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKY
TNRLSLRFVEPDLETRFSVEKEKQSGAAFSCSCVVLLFTAVIEALIDPLLIANYVTLAVG
EVVLLILTICSLAAIFPRVFPKRLVSFSTWIDHTRWARNTWAMAAIFILTLADIIDMLSC
RPPLPPATNSVTEGSPAPVGLRGCLENPKYYSYVAVLALIATTMLVQVSHMVKLTLMLLI
TVATGVVNIYSWRDIFDQYDLVRYEEYRVYLVPSKYTMTVMIFIMMVSFYYFARHVEKLA
RTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGV
MFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTYMAA
SGVTPDNNTNGYACMKKEELSDRERWQHLADLADFALSMKVTLMNINYQSFNNFMLRIGL
NKGGVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKDYGFRFVRRG
PIFVKGKGELLTYFLKGREKQGSFINGSSVTLPHQVVDSS
NT seq 3363 nt   +upstreamnt  +downstreamnt
atgcctaggaacagggccttctctgagccagagtactctgctgagtactcagcggactgc
tccgtcacactgccgtctgaccccggacaggccgtgggacgcacccatgaggtgacagtg
cgcagctcaggctgctgcttgtgcctgccacggttcatgctcctcacctttgcaccggac
tctttggagaatctctatcagacctattttcgcaggcagcggcacgaaaccctcttggtg
ctggtggtgtttgcggccctgtttgactgctacgtcatagtaatgtgcactgtggtctac
accagcgacaagctggcatctgtggccgttgcgtctgtaggcctggccgcagatgtcttg
ctctatctactatgccgctatggcctactgccagagcgcatctcccgcagactggtgccc
tatgccctctgggtgctcatagctgcccagatcttctgctacctgggactgaactttgct
cgcttccaccaggccagcgacacggtcggctggcaggcctttttctgtttctccttcttc
ttgacgctgccattaagactgacacccatagttctcatcacaactgtgtcctgtggggtg
cacaccctggtattgggggtcaccatagctcagcagcaacaggaagacatccagggagct
gctcttggaagacagctactggccaacatcctgatctacctatgtgccatcacagtgggg
gtcatgtcatattacatggctgaccgcaaacaccgcaaggcctttctggaggccaggcag
tctttggaggtgaagttgaacttggaggagcagagccagcagcaggagcgtctcctgctg
tccattctgcccaagcacatagcagatgagatgctacaggacatgaagaaagaagccagt
cagaaggagatgcagcagttcaacaccatgtacatgtatcggcatgagaatgtcagtatt
ctgtttgcggacatcgtgggcttcacacaactctcctcctcctgtagtgcacaggagctt
gtcaagctgcttaatgagctgtttgcccgttttgacaagctggctgccaaataccaccag
ttgaggattaagatcctcggggattgctactactgtatctgtggccttccagattacaga
gaagaccatgcagcctgctccataatgatggggttagccatggtggaagctatttcgtat
gttcgagaaaagacgcagacagatgtggatatgcgtgttggggtgcactctgggacagtt
ctcggtggagtgctgggacagaaacgctggcagtatgatgtgtggtccacagatgtgaca
gtggcaaacaaaatggaggctggggggattcctgggcgagtgcacatctctcagaacaca
ctagaatgtcttcatggggaatttgatgtggagccagggaacgggggtgaccgctgtgaa
tacctaaaggaaagaggcatcgagacgtatttggttgtcgttcctaagggccccataagc
aaaaatggcataaatggagtaaagctgtcagtgacttcctcaaatgggaactctccactg
ttgatcaacactacagagtgtaacggcagtgtgcacacagcctgcactacacccgaggag
ccagaggagctggacgcacgggtggtgaacccctcgttcccgaaccctcgacgacgtctt
cgtttgcgagacctggccgaaagggtgattgatgctcaggaaaacgagcaggaactgaat
aaactcctaaatgaggctctgttggagagagagacagtgcaggcactaaaaggaaagtac
acaaaccgtctgtccctgcgctttgtggagcctgacctggagacacgcttctccgtggag
aaggaaaagcagagtggggctgctttcagctgctcctgtgtggtgctgctcttcactgca
gtcattgaggctcttatagaccctctgttgatagctaactatgtgactcttgctgtgggg
gaagtcgtattgctcattctcaccatctgctccctggcggccattttcccacgggtattt
cctaaaaggctggtttcattctccacatggatcgatcacacacgctgggcgcgcaacact
tgggctatggctgccattttcatcctcacactggcagacataatagacatgctaagctgt
cggccacctctgccccctgctacaaactcagtgacagaaggttctccagccccagtggga
ctgaggggctgcctggagaaccccaaatactacagctacgtagccgtattagcgctgatt
gccactaccatgctggtgcaggtcagccacatggtgaagctcactctcatgctgctaatc
acagtggccacaggtgtggtaaacatctacagctggagggatatctttgaccagtatgat
ctggtacgctatgaggagtacagagtttacctcgtgccctctaaatacacaatgactgtg
atgatcttcatcatgatggtcagcttctactactttgctcgacatgttgagaaactggcc
cgcacattgttcctgtggaaaattgaggtgcatgagcagaaggagaaagtgtatgagatg
aggcgctggaacgaggctctggtcaccaacatgcttccggagcatgtcgctcgccacttc
ctgggctccaaaaagagggatgaggagctgtacagccagtcttatgatgagattggggtt
atgtttgcctctatccctaatttctccgacttctatacggaagagagtatcaacaacggg
ggtatcgagtgtctgaggttcctcaatgaaatcatctctgactttgatagtcttctggat
gaacctcagttccgctgtatcaccaagattaagactatcggcagtacctacatggcagca
tcaggggtcactcctgacaacaacactaatggctatgcttgcatgaagaaagaagaactg
tctgatagggaacgctggcagcacttggctgatctggcagattttgcgctctccatgaag
gttaccctcatgaacatcaattaccagtcatttaacaacttcatgcttcggattgggcta
aacaaaggtggtgttctcgctggagtcataggggctcgaaagcctcattttgacatttgg
gggaacacagttaatgtggccagtcgcatggagtctactggggtgatggggaacatccag
gtggtggaggattgctataacatcctaaaggactacggcttccgttttgtcaggagggga
ccgatctttgtgaaggggaaaggggagctcctcacctattttctgaaaggacgggaaaaa
cagggttccttcatcaacggctcttctgtcacattgcctcaccaggtcgtggacagctct
tga

DBGET integrated database retrieval system