KEGG   Astyanax mexicanus (Mexican tetra): 103027968Help
Entry
103027968         CDS       T05042                                 

Gene name
setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103027968 (setdb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amex03036]
    103027968 (setdb1)
Enzymes [BR:amex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103027968 (setdb1)
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103027968 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103027968 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF5604 Tudor_4 TUDOR_5 MBD Pre-SET DUF4537 Flagellar_rod
Motif
Other DBs
NCBI-GeneID: 103027968
NCBI-ProteinID: XP_022529762
LinkDB All DBs
Position
11
AA seq 1117 aa AA seqDB search
MEVDSAVGSGGLEMELGPELEEELGVSLDELREWIEQQVDSSEAVQQRKAQLSELQDWVE
TREKEMANVDTLCSTASDSVTQCESLVKELYSKMGLVYRESSSDDDGGGDGSASEIIEID
DDDDDDVIAVGCAASSKRKGSRSVAAESVGNVVPPKKVVTPVKDSTFKEASAAIQRTSQQ
VQNLMQTVTKSTPSGSNAIVPPKVVAPPTQSRGPMMNIPAVFVSSAPGNSATQPNPAIKQ
DAMKVNMSILGKKRTKTWHRGTLVAINSVGNSFKYKVKFENKGKSLLSGNHVAFDYHPTL
ERLYVGARVVAKYKDGNQVWLYAGIVAEMPNSKNRMRFLIFFDDGYASYVGLPDLYPICR
PLQKSWEDIEDESCRDFIQEYITAYPNRPMVLLKPGQIIKTEWEGTWWRSRVEEVDGSLV
KMLFLDDKRSEWIYRGSTRLEPMFNLKISAANSQDKKLGGLQRPRPNMVPMRPRGPVVQY
NSNENNSLPGRPAGPQFTGPRPQFPCPPAGHAPWFFLLQSSPVQTLIPMAPSQQAMQPAV
SAYGGERIPQEPSYQAPNDRLFYLSHSCTPDCLKRVRPTRPNMHRGRNPLLTPLLYEFRR
MTARRRLNRKMSFHVIYKSPCGLSLRNMGEIQRYLFQTTCDFIYLEIFPVYRSKCACHQL
TLQATGCTPGGQINANAGYNSKRLDECLPTGIYECNKRCRCNHQMCINRLVQHGLQVRLQ
LFKTQNKGWGIRCLDDVAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENF
KEGYESEAHCSDSEGSGVDMNRVKVRAPNQQGKHPRKSEDRNSSTTGKGQGSSESGDSDE
DKDSNPDESDSSDDTFVKDTHYTSSSVWRSYTTRRQSKGLKEESQDSKDGMSVTGGGTEE
QKPPPMPEESGKSKVASWLTSQSESTGDQSVKAEEQPKTEKKEVMTLSDSDDVQTISSGS
DDNKEREKKTQAVVKRQVAVKSTRGIALKGPHGIKMKVGGGAGGGAGGGGNQGQGGEGGP
KTTRQFFDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKR
IRAGTELTWDYNYEVGSVEGKELLCCCGSTECRGRLL
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggactccgccgtgggctctggaggcctggagatggagctgggtccggagctg
gaggaggagttgggtgtttctctggatgaactgcgcgagtggatcgagcagcaggtggac
agcagcgaggctgtgcagcagaggaaagctcagctatcggagctgcaggattgggttgag
acgagggaaaaagagatggctaatgtggatacgctctgctccactgcttcagattcagtt
acgcagtgcgagtccctggtgaaagagctgtacagtaaaatgggtctggtgtatcgggag
agtagttctgatgacgatggcggaggagacggcagtgcttctgagattattgaaattgat
gatgatgatgacgatgatgtcatcgctgtgggctgtgctgcatcaagtaagcgtaaaggc
agtaggtcagtagctgcagaaagtgtggggaatgtggtcccaccaaagaaagttgtgacc
ccggtcaaagattcaacgtttaaggaagcctcggcagctattcagagaacttcacagcaa
gtgcagaacttgatgcagacggtcaccaaaagcaccccgtccggatccaacgccatcgtt
ccacctaaagtggtggccccgcccactcagagccgaggtcccatgatgaacatcccggca
gtgttcgtgtcctcagccccaggaaactcggccacccagccaaacccggccataaaacag
gacgccatgaaggtcaacatgagcattctgggtaaaaaacgcaccaagacgtggcaccgc
ggaaccctcgtggccatcaactccgtgggaaacagttttaagtataaagtgaagtttgag
aataaagggaagagtctgctgtctgggaatcacgtggcctttgactatcaccccactctg
gagaggctgtacgtgggagcccgggttgtcgccaaatacaaagacggaaaccaggtgtgg
ctgtacgccggtattgtggccgagatgcccaacagcaagaaccgtatgaggttcctcatc
ttttttgacgatggctatgcttcctacgtgggccttcctgacctttaccccatatgcaga
cccttgcagaagtcgtgggaggacatagaggatgagtcgtgtcgggattttattcaggag
tacatcaccgcgtaccccaacaggcctatggtcctgctgaagccaggccagatcattaaa
accgagtgggaggggacgtggtggaggagccgagtggaggaggtggacggcagcttggtg
aaaatgctgtttttggatgataagcgcagtgagtggatctatcgtgggtccacccgtctg
gagcccatgttcaacctgaaaattagtgcagccaacagccaggataagaagctcggaggc
ctgcagaggccaagacccaacatggtaccaatgagacctcgaggacctgtcgtccagtac
aattctaatgagaacaattcgttacccggtcgacctgcaggccctcagtttacaggacct
cggccgcagttcccctgcccccccgcaggccatgcgccctggttcttcctgctgcagtcc
agtccggtgcagaccctcattcccatggccccgtcccagcaggcgatgcagccggcggtg
tctgcgtacgggggcgagcggatcccccaggagccgtcctatcaggcccccaacgaccgc
ctgttctacctctcccactcctgcacccccgactgcctgaaacgtgtccggcccacccga
cccaacatgcaccgcggccgcaaccccctcctcacacccctgctgtacgagttccgccgc
atgaccgcccgcagacgcctcaaccgcaagatgtcgttccacgttatctataagtctccg
tgtggtctgagcctgaggaacatgggggagatccagcgctacctcttccagacgacctgt
gacttcatctacctggagatttttcctgtgtacaggtctaagtgtgcctgccaccagctg
acactgcaggctaccgggtgtactccagggggtcagataaacgccaacgcagggtacaac
agcaagaggctggacgagtgcttgcccacagggatatacgagtgtaacaagcgctgccgc
tgtaaccatcagatgtgcattaaccgcttggtgcagcacggcctgcaggtgcgcctgcag
ctctttaaaacccagaataaaggctggggcatccgctgcctcgacgacgtggccaaaggt
tccttcgtctgcatctacgcaggcaagatcctcacggatgactttgcggataaagaaggc
ttggagatgggagacgagtactttgctaacctggaccatattgagagtgtggagaatttt
aaggagggctatgagagcgaggcgcactgctcggacagcgagggcagcggcgtggacatg
aaccgggttaaagttcgagctccgaaccagcagggcaaacatccccgcaagtcagaggac
cgcaacagcagcactaccggcaaaggccaaggctcgtctgaatctggagacagcgacgag
gacaaggactcgaaccctgacgagagcgacagctcagacgacacgttcgtaaaagacaca
cactacacgtccagctctgtgtggaggagctacaccacccgccgacagagtaaaggcctg
aaagaggagagtcaggacagtaaggatgggatgagcgtgacgggtggaggaacagaggag
cagaagcctccccccatgcctgaggagagcggaaagagtaaagtggcgtcttggttgacc
agccagtctgaatctactggagatcaaagtgttaaagcagaggaacaaccgaagactgag
aagaaggaagtgatgaccctctcggacagtgatgatgtgcagaccatcagctccgggtca
gacgacaacaaagagcgtgaaaagaagactcaggcggtggtgaagaggcaggtggcggtg
aagtccacgcggggcatcgctctgaaaggccctcacggtataaagatgaaggtgggcgga
ggtgccgggggcggggccggagggggtggtaatcagggccaaggcggagaaggcggcccc
aaaaccacccgtcagttcttcgatggggaggagtcttgttacatcattgatgctaaatta
gagggaaacctgggacgatacctcaaccacagctgcagtcctaacctgtttgtgcagaac
gtgtttgtggacactcacgacctgcggttcccctgggtggcgttcttcgcaagcaagcgt
atccgtgcggggacagagctgacctgggactataactatgaggtgggcagtgtggagggg
aaggagctgctgtgctgttgtggatctacagagtgtcgtgggcgcctgctgtaa

DBGET integrated database retrieval system