KEGG   Astyanax mexicanus (Mexican tetra): 103027992
Entry
103027992         CDS       T05042                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04080  Neuroactive ligand-receptor interaction
amex04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103027992
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103027992
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:amex04030]
    103027992
G protein-coupled receptors [BR:amex04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    103027992
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 103027992
NCBI-ProteinID: XP_022530171
LinkDB
Position
12
AA seq 373 aa
MSLMGGTVAPKPVCYTNATVKFFYESSGKNISDTWRTQDYIVVGLGLTVCVFIILANILV
ITAIFINRRFHYPIYFLLGNLAAADLFAGIAYLHLMFHTGPWTQRLTRYQWFLRQGLIDT
SLTASVINLMAIALERHQTIFTMQLHSKMTNRRVFLLILSIWLVATLMGLVPTLGWNCVC
NLARCSKMAPLYSRDYLVFWAVLNLVSFTIMVVVYTRIFIYVRHKSQRMSQHTTQSRHKE
TVESLMRTVFVILSCFVICWTPGLVLLLLDGVNCGIIVLKFEKYFLVLAEFNSLMNPIIY
SYRDQDMRRTFKRILCCLCPRAGHKGPHAGVRFNTLDQEAHKMTCIEEDPNRHPNGTHLV
LQGANDLQNSSVS
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtccctaatgggcggcacagtggcacccaagccagtctgctacaccaacgctacggta
aagttcttctacgagtcgtctgggaagaacatctcggacacatggaggacgcaggactac
atcgtggtgggacttggactgacggtgtgcgtcttcatcatcctggccaatatcttggtc
attaccgccatattcattaaccggaggttccactacccgatctacttcctgctggggaac
ctggcggcggcggatctcttcgccgggatcgcctacctgcacctgatgttccacacgggg
ccgtggacccagaggctcaccagataccagtggttcctccgacagggtttgatagacacc
agtctcacggcgtcggtgattaatttgatggccatcgctctggagagacaccagaccatc
ttcaccatgcagctgcacagtaagatgacgaaccgccgggtgttcctgctgatcctcagt
atctggctggtggccacgctgatggggctggtgcccacgctgggctggaactgcgtctgt
aacctggccaggtgctccaagatggcgccgctgtacagccgggactacctggtgttctgg
gcggtgctgaacctggtgagcttcaccatcatggtggtggtctacacccgcatcttcatc
tacgtccggcacaagagccagcgcatgagccagcacaccacccagtcccgccacaaggag
acggtggagagcctgatgaggaccgtcttcgtcatcctgagttgtttcgtgatctgctgg
actccaggtttggtcctgttgttgctggacggggtaaactgcggcatcatcgtcctgaag
tttgagaagtacttcctggttctggccgagtttaactccctgatgaacccgatcatctac
tcgtaccgggatcaggacatgcgccgcaccttcaagcgtatcctgtgctgcctgtgtcct
cgcgccggccacaaggggccgcacgccggcgtccggttcaacaccctggaccaagaggca
cataagatgacatgcattgaagaagacccaaacagacacccgaacgggactcacctggtg
ctacaaggtgctaacgatcttcagaactccagcgtgagctga

DBGET integrated database retrieval system