KEGG   Astyanax mexicanus (Mexican tetra): 103028521Help
Entry
103028521         CDS       T05042                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00010  Glycolysis / Gluconeogenesis
amex00051  Fructose and mannose metabolism
amex00052  Galactose metabolism
amex00500  Starch and sucrose metabolism
amex00520  Amino sugar and nucleotide sugar metabolism
amex00524  Neomycin, kanamycin and gentamicin biosynthesis
amex01100  Metabolic pathways
amex01200  Carbon metabolism
amex04910  Insulin signaling pathway
Module
amex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
amex_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103028521 (hk1)
   00051 Fructose and mannose metabolism
    103028521 (hk1)
   00052 Galactose metabolism
    103028521 (hk1)
   00500 Starch and sucrose metabolism
    103028521 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    103028521 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103028521 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103028521 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amex04131]
    103028521 (hk1)
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103028521 (hk1)
Membrane trafficking [BR:amex04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103028521 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1758 CSD
Motif
Other DBs
NCBI-GeneID: 103028521
NCBI-ProteinID: XP_007240896
Ensembl: ENSAMXG00000012670
UniProt: W5KZZ4
LinkDB All DBs
Position
25
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLRDIKARFRMELEKGLSRDTNPTAT
IKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQNYETPEDIIH
GSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCVQTKLDEAVLLTWTKRFKVNGV
EGMDVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHISAIEKTKEGLTKAKEILTRLG
VEPSADDCIAVQHVCAIVSFRSANLIAATLGAILNRLKDNKNVPRLRTTVGIDGSLYKMH
PQYSRRLHKTVRRLVPECDVRFLLSESGSGKGAALVTAWASRLADQTRQIAEILAEFRLT
QDQLLEVKKRMLTEIQTGLSKKTQDKATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVACISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGILVNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIETVDGDQGRMCVNMEWGAFGDNGCLDD
IRTQYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGAVSRRAAQICGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCDVNFLLSEDGSGKG
AALITAVGCRLREQEQKS
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgcacagcttctggcctactacttcactgagctgaaggatgaccaggtcaaa
aagatcgataagtacctgtattccatgcggttctctgatgagacgctgcgggacatcaag
gcccgtttccgtatggagctggaaaaagggctgagccgggacaccaaccccacagccacc
atcaagatgctgcccacctttgtcagatccatccctgatggatcagagaagggggatttt
attgctctggatctgggtggctctaatttccgaatcctgcgtgtgaaagtctctcatgag
aagaaacagacggtgcagatggagagtcaaaattacgaaacccctgaggacatcatccat
ggcagtggatcacggttgtttgaccatgttgcagaatgtctaggagactttatggagaag
caaaagatcaaagacaaaaaactgcctgttggattcactttttctttcccatgtgttcaa
actaaactggatgaggctgttttgctgacttggaccaaacgatttaaagtcaatggagtg
gaaggaatggatgtggtcaagcttctgaacaaagctatcaaaaagcgaggggattatgat
gcagatatcatggcggtggtcaatgatactgtgggaactatgatgacctgtggctttgat
gatcagcgctgtgaagtaggaatcatcattggtacaggcactaatgcatgctacatggag
gaactgagacacattgacctggtggaaggagacgagggcaggatgtgtatcaatacagag
tggggagcttttggagacgatggcatgttagaggacatccgcactgagttcgacagagag
attgaccgtggatctcttaaccctggcaaacagctgtttgaaaagatggtgagtggtatg
tacatgggggagctggtcaggctcatcctggtgaagatggccaaagagggactgctgttc
gagggccgcatcactcctgagctgctgacgaaaggcaaatttgaaacaaagcatatttca
gccattgagaagactaaagagggtctgaccaaagccaaggaaattctgacccgcctgggc
gtggagccatcagcggatgactgcatcgcagtgcagcacgtgtgtgccattgtctctttc
cgctctgccaacctcatcgctgctaccctgggtgctatcctcaatcggctgaaggacaac
aaaaacgtacctcgcctccgtaccaccgtgggcattgatggatccctttacaagatgcat
ccacagtattctcgacggctgcacaagaccgtccgccgtctggtaccagaatgtgatgtg
cgcttcctgctctcagagagtgggagtggcaaaggtgctgccttggtgacagcctgggct
tctcgattggctgatcagacccgtcaaatcgcagagatcctggctgagttccgcctcacc
caggaccagctgctggaggtgaagaagagaatgctcacagagatccagactggcttgagc
aagaagactcaggacaaggctactgtcaaaatgctgcccacctatgtccgcagcactcca
gatggaacagaaaatggtgacttcctggccttggatcttggaggcacaaactttagagtg
ctcttagtgaagattcgcagtggtaaaagaaggactgtggagatgcataacaaaatctat
gccattcccatagaggtgatgcagggaacaggagaagagctctttgatcacattgttgcc
tgcatatcggacttcctggattacatgggcatgaagaacgcccgactgcctttgggcttc
accttctccttcccttgcagacagaccagcctagacgctggcattcttgtaaactggaca
aagggcttcaaggccacagactgtgaaggagaggatgtggtaaatctcttgagggagggg
attaaaaggagagaggagtttgacctagatgtagtagcagtggttaatgacacagtggga
accatgatgacttgtgcatatgaggagccaacatgtgaagtcggccttattgcaggaacg
ggcagcaatgcatgctacatggaggagatgaagaacattgagacagtggatggagaccag
ggcagaatgtgtgtgaacatggaatggggtgcttttggagacaatggctgtttggatgat
atcaggacccagtatgacagagctgtggatgacctctccctcaaccctggcaaacagagg
tatgagaagatgtgcagtggaatgtacctgggtgagattgtgcggaacatccttattgat
ttaacaaagcgtggcttcctcttcagagggcagatttctgaaactctgaaaacaaggggc
atcttcgaaactaaattcctgtcccagattgagagtgaccgtctggctctactgcaagtg
aggtccattctgcagcacttgggtctggacagcacgtgtgatgacagtattatagtaaag
gaggtgtgtggggcagtgtcacgccgagctgcgcagatctgtggagcaggaatggctgct
gttgtggacaaaatccgggagaataggggactggaccatctggacatcactgttggcgtg
gacggcacgctctacaaactccatccacatttctcccggataatgcaccagaccgtcaag
gaactcgctccaaagtgcgatgtgaacttcctgctgtctgaagatggaagcgggaagggt
gctgccttgatcacggccgtgggatgccgcctgcgtgagcaagagcaaaaaagctga

DBGET integrated database retrieval system