KEGG   Astyanax mexicanus (Mexican tetra): 103029218Help
Entry
103029218         CDS       T05042                                 

Gene name
lct
Definition
(RefSeq) lactase-phlorizin hydrolase isoform X1
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00052  Galactose metabolism
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103029218 (lct)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     103029218 (lct)
    3.2.1.108  lactase
     103029218 (lct)
Chaperones and folding catalysts [BR:amex03110]
 Intramolecular chaperones
  Others
   103029218 (lct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 103029218
NCBI-ProteinID: XP_022535907
LinkDB All DBs
Position
19
AA seq 1922 aa AA seqDB search
MKMKGWGTVLLLWLLSFSRSSCDEKPSQDFMLFAGPLTKQFLNDLKTNPFASQTFQASGA
SVAEDVFDCREPLPALSREYFQYLQSRGVTHFKVPLSWLNILPTGQSSQPHEDTVRCYRT
LIKELTDSRIQPLLELHRSEVPEGLRQRYGDWTNPAMTQAFQDYAVFIHTTFKDQVKTYM
TFSHIHELQNSPQLRHALQAHTAVYNIYHQMSKDVRVSIGARASDVAGLYHVSPVYMRYI
DLISVYMEYDCTSKTSLTEALTDTQLQIGQRSILMYQMRTKNCADSSFQPLISVLEALKN
TEVHLIGCDITDLLGKLDHTDESVQSDDSKSHDKEQRTSSLSYQNVWDKFKTQTPAERDL
FINGSFPHSFQWAVSTDSFKVEGGWSEHGKGETIWDRFGHEGKVSDNQTADVACDSYHKV
EYDMYLLRGIHAPNYQFSISWARIFPTGTKESLLEKGALYYDKLIDALLKSGVEPTVTLH
SGDLPQALQDYGGWTNSSIVEIFKEFADFCFFRYGNRVKTWNTFSSPWVISNFGYGTGEH
PPGIKDPTSAPYQVTHNIIKSHAEAFHVYNDKYRKLQDGKVGIALNSDWAEPHNLDSPPD
VEAAERYLTFMLGWFAHPIFVDGDYPALLKTQIELKNTRCGAELAVLPVFTEDEKRRIKG
TADFFGINHHTSRLINESRGSCVAGPGSVGDFESHIDSTWPTTASSQIQSVPWGLRRLLN
YIYEEFTSVARVPIYITGNGMPTEYSSDIFNDTQRVEFLKAYINEAMKAILLDSVAVQRF
TVQSLIDGFEGPQGYSERYGLHYVNFEDPDRPRTPKASAYYFSQVIERNGFGEKTVTSSG
QTIATRYQESSRRVSLPPSEVPSKSKVVWEKFSPQSRFQKKLYHYGTFPEDFQWGVSTSA
YQIEGGWDADGKGPSVWDTFTHTPGSIKNDDTGDVACDSYNKLEEDLYMLRALKVKAYRF
SLSWPRIFPDGYRTSLNQKGVDYYNRLIDGLIANNITPMVTLFHWDLPQALQDIDGWDNV
AMIEIFNDYADFCYETFGDRVKFWMTFNEPFVTSWVGYGPGIVPPNIKSPGDAPYRVTHN
ILKAHAKAYHTYDDKYRKTQHGLVSISLNTEWIEPLDVNVPREIAAADRALQFQLGWFAH
PIFKNGDYPDAMKWQVGNKSELQGLAESRLPTFTEEEKAYIQGTADVFCLNTYSARQARH
VTARLSPRSYEYDQDIAADDVSDSQATAMKELRAAAWGLRRLLNWIKEEYGDPEIYITEN
GVSTDTSITVDDTDRIFYLKTYIDEALKAHNLDAVRLKGYTAWSLMDNFEWINGYSVGFG
LHHVDFKHPDRPRTPKRSTHYYYKVMRDNGFPLPEEEKPLYGHFREGFAWSVATASYQIE
GGWRADGKGLSIWDTFAHTPLRVGNDDTGDIACDSYNKISEDVEMLKKLKVNHYRFSISW
PRIMPDGTTSTINEAGLNYYHRLVDALLKANIKPQATLYHWDLPQALQNVRGWENDTIVE
RFKDYADVVFKSLGDKVKFWITINEPYNVANIGHGYGTAAPGISLRPGTAPYIVAHNLIK
AHAEAWHLYNDKYRATQGGIVGITINSDWAEPRNPYKQEDYEAARRVVEFQIGWFAHPVF
NGDYSDVMKNRIRERSLAAGQAKSRLPEFTPEEVKRIKGTYDYFGFNHYTTILAFNLDYK
NLQHYDADRGAGTIHDRSWLDSGSSWLKVTPPGFRTILNFIKNEYGNPPIYITENGISER
GDMDLNDIHRIHYYENYINQALKAYLLDDVDIRGYTAWTLMDNLEWATGFAEKFGLFYVN
RSDPSLPRIPKKSATHYATIINCNGFPDPSQGPHECQTLEPEEHPPTEGPEATKLPPTEK
PMPVNFLGMEVSAPDAEVALYVLFSLTIAGVITVAIITYQCIKVKKRSKHLSEEHIALER
KF
NT seq 5769 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaagggctgggggacggttcttcttctgtggctgttgagcttctcccggagc
tcttgcgatgagaaaccttcgcaggacttcatgctcttcgcaggtcctttaaccaagcag
tttctcaatgacctgaaaaccaatccgtttgccagtcaaacttttcaggcttcaggtgcc
tcagttgccgaagatgtcttcgactgcagagagcctctcccagcactgtccagagaatac
ttccagtacctgcagagccgaggggtgacccatttcaaggttcctctgtcctggttaaac
atccttccaacaggacagtccagccagccccatgaagacaccgtgagatgctacaggacc
ctcataaaggaactcacagactcacgcatccagcctctgctggagctccaccgatctgaa
gtaccagaaggcctgaggcaaagatatggagactggacgaaccctgccatgacacaggcc
ttccaggactatgctgtttttatccacactacatttaaggatcaggtcaagacatacatg
acatttagccacatacacgagctccaaaattcaccacagctacgccacgccttgcaggct
cacacagcggtgtataatatctatcatcagatgtctaaagatgtccgtgtctccattgga
gcgagagccagtgatgtcgcgggtctataccatgtaagccccgtgtacatgagatatatc
gatttaatatctgtgtatatggagtatgactgcaccagcaaaaccagcctgactgaggca
cttaccgacactcagctgcagattggtcagcgctctattctgatgtatcagatgaggact
aagaactgtgctgacagcagctttcagcctctcatcagcgttcttgaagctttgaaaaac
acagaagttcatcttattggctgtgatatcactgacctcctagggaagcttgatcacaca
gatgaaagtgtgcagagtgatgactcaaagtcccacgacaaggagcaaagaacatcttca
ctctcttatcagaatgtctgggacaaattcaaaactcaaaccccagctgaaagagatctg
ttcatcaatggttccttccctcatagcttccaatgggcagtctccactgactctttcaag
gtggagggtggctggtctgaacacgggaaaggggaaactatctgggatcgctttggtcat
gaaggcaaagtctctgataatcagacagccgatgtggcgtgtgatagctaccacaaagtg
gagtacgatatgtacctgctcagaggcattcacgctcctaactatcagttctcaatttct
tgggctcgcattttccccaccggtacaaaggaaagtctgcttgaaaagggagcgctttat
tatgacaagctgatcgacgcactcctcaaatctggtgttgaacctacagtcacgttacat
tctggggacctgcctcaagctctgcaggactatggaggttggaccaacagctccattgtg
gagatcttcaaagagtttgctgacttttgcttcttcagatatggaaacagagtgaagacc
tggaacacttttagcagtccttgggtgatcagtaactttgggtatggtacaggggaacat
cctccaggtattaaggacccaacttcagctccttaccaggtgacacacaacataataaaa
tctcatgcagaggcctttcatgtctacaatgataaatacagaaagttgcaggatgggaaa
gtgggcatcgctctcaactcagactgggcagagccacataaccttgacagtcccccggat
gtagaagctgcagaacgctacctgaccttcatgctgggatggttcgctcatcccatattt
gtagatggggattatcctgcgctgctgaaaacacagatcgagctgaagaacactagatgt
ggtgcagagctagctgttcttccagtgtttacagaagatgagaagcggaggattaaaggc
acggctgatttctttgggataaatcaccacacatcccgtctcatcaacgagagccgggga
agctgtgtcgcaggaccaggcagtgtcggggactttgagagtcatattgactcaacgtgg
ccaacaacagcatcaagccaaatccaatctgtgccatgggggcttcgccgattgctgaat
tatatttatgaggagttcacatcagtggccagagtgcctatttacatcactggaaatggg
atgccaacagaatatagtagtgatatcttcaacgacactcaacgtgtagagttcctcaag
gcgtacatcaacgaggcaatgaaagccattctcctggacagtgttgctgtacagcgattc
acagtacagtccctgattgatggctttgagggtcctcaaggctacagtgaaagatatgga
ttgcattacgtcaatttcgaagatcctgacagacccagaactccaaaagcttcagcttac
tacttctctcaggtcattgaaagaaacggtttcggagagaaaacagtgacctcttctgga
cagaccattgccacaaggtaccaggaaagttccagacgtgtcagtctaccaccatctgaa
gtcccttcaaagtctaaagttgtttgggagaagttctcaccacaatccagattccagaaa
aagctttatcactatggaacttttccagaagatttccaatggggcgtttcaacctcagca
tatcaaatcgaaggtggctgggacgctgatggtaagggacctagtgtgtgggatacattc
acccacacgcctgggagcatcaaaaacgatgacactggtgacgtggcttgtgatagctat
aataaactggaagaagatctctatatgttgagagctcttaaagtgaaagcatacaggttc
tctctatcttggcccaggatattccctgatggttatagaacgtctctaaaccagaagggg
gttgactattacaatcgactcatagatggtctcatagcaaataacatcacgccaatggta
acacttttccactgggacctccctcaagctctacaagacattgatggctgggacaatgtt
gctatgattgaaatattcaatgactacgccgacttctgctatgaaacctttggagacaga
gtgaagttctggatgacctttaatgagccttttgtaacttcttgggtaggctatggaccg
ggtatagttcctcctaatatcaagagccctggtgatgctccttatagggtgacacataac
attttaaaggctcatgctaaagcatatcacacatatgatgataagtatcgaaaaacccaa
cacgggctggtgtccattagtctgaacactgagtggattgagcctctggatgtaaacgta
cctcgagagattgcagctgctgacagggccctccagttccagcttggatggtttgcccat
cccatctttaagaacggagactatcctgatgccatgaagtggcaggtgggcaacaagagt
gaacttcaaggcttggcagaatccaggttgcccacttttaccgaagaagagaaggcctac
atccaaggcactgctgatgtcttctgcctcaatacttacagtgccagacaggctcgtcat
gtgactgccaggctctcgcccagatcttatgagtacgatcaggatattgctgcagacgac
gtgtcagactctcaagccactgcgatgaaggaattgagggcagcagcttggggactgagg
agactcctcaactggataaaggaggagtatggggaccctgaaatttacattacagagaat
ggagtctctacagatacgtccataacagtggatgacaccgacaggatattctacctgaag
acctacattgatgaagctctcaaagcacacaacctagatgcagtacgcctcaagggctat
acagcttggtcactcatggacaattttgagtggattaatggctacagtgttggctttggg
cttcaccatgtggatttcaaacaccccgatcgtccaaggactccaaaacgcagtactcac
tattactacaaagtcatgagagacaacggttttccactgccggaggaggagaagcctctg
tacggtcacttccgtgaaggatttgcatggagtgtagctacagcatcttaccagatcgag
ggaggctggagagcagatgggaaaggtttgagcatctgggacacgtttgctcatacgcct
ctcagagtgggaaatgacgacactggagacattgcttgtgatagctacaacaaaatcagt
gaagatgttgaaatgctcaaaaagctcaaggtcaaccactaccgtttctccatatcgtgg
ccgagaatcatgcctgatgggactacaagcacaatcaacgaggcaggactgaactattat
catcggctggtggacgcgctgttgaaagccaacataaagcctcaggcgacgctgtatcac
tgggacctccctcaggctctgcagaatgttcgcgggtgggagaacgacacaatcgttgaa
agatttaaggactacgccgacgttgtctttaaaagtttaggagacaaagtaaagttctgg
atcacaattaacgagccatacaatgttgccaacattggacatggttatggcactgctgca
ccaggcataagtttacggcctggtacagcaccctacattgtggcccacaatctcattaaa
gcccacgctgaagcctggcacctatacaacgacaagtaccgtgccactcaaggtgggatt
gtcggcatcaccataaactcagactgggcggagcctagaaacccctacaaacaagaggat
tatgaagcagccaggcgtgttgtggagttccagattggctggtttgctcaccctgtgttt
aatggagattacagtgatgtgatgaagaacagaatacgagaaagaagcttggccgctggt
caggccaaatcacgtcttccagaatttacccctgaagaagtgaaaaggataaaaggcact
tatgattactttggattcaaccattacaccactatcttggctttcaacctggattacaaa
aatcttcagcactatgatgcagacaggggagcagggacaattcatgaccgctcctggttg
gactctggatcttcctggctgaaagtgactccacctggattcagaacaatcctgaacttc
atcaagaatgagtacggaaaccctcccatctatattacagagaacggcatctctgaaaga
ggcgatatggacctgaatgacattcacagaattcactactatgaaaactacatcaaccag
gctctgaaagcttatttgcttgatgacgtggacatacgtggctacaccgcctggacgctg
atggacaatctggagtgggccactggatttgctgagaaatttggcctcttctatgttaac
cgttctgatccatctctgccacgaatccccaagaaatctgccacacactacgctactatc
atcaactgcaacggcttcccagatcctagccagggaccccatgaatgtcagactctggaa
cctgaagaacaccctcccacagaaggacctgaagcaacgaaacttcctcccactgaaaaa
cccatgccggtaaattttctgggtatggaagtgtctgctcctgatgccgaggtggcgctc
tacgtcctcttcagtctcactatcgcaggcgtaatcacagttgccatcatcacctaccag
tgtattaaagtgaagaagagatcaaaacatctctcagaggagcacatagctcttgagagg
aagttttaa

DBGET integrated database retrieval system