KEGG   Astyanax mexicanus (Mexican tetra): 103029534Help
Entry
103029534         CDS       T05042                                 

Gene name
hdac4
Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103029534 (hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amex03036]
    103029534 (hdac4)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103029534 (hdac4)
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103029534 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 103029534
NCBI-ProteinID: XP_022535909
LinkDB All DBs
Position
19
AA seq 1050 aa AA seqDB search
MTSHSHQDGLPSKEQPLELLKPSGLNHIPSVDVSAALPIPVPPAAIPMDLRVDHQQQKHL
SLASVEPAPREQQLQQELLALKQKQQIQRQLLIAEFQRQHEQLSRQHEAQLQEHVKHQQE
LLALKHQQELLEHQRKLERHRREQELEKQQREQKLHQLKNKERGQESAVASTEVKMRLQE
FVLNKKKALVQRSLNHCMPSDPRYWYGKTQHSSLDQSSPPQTGISTYNHPVLGLYDSKDD
FPLRKTASEPNLKLRSRLKQKVTERRSSPLLRRREGPITTAKKRSLDMAESACNSAPGSG
PSSPNNSSNNITNENGIAGSISNSPVEPSLAHRLAGREGPVSHLSLYTSPSLPNITLGLP
APSSSSVASGQQEGERLAMANLQPGLSLTTPFIPGAHLPTYLAASALEREGGSAHNPLLQ
HMVSQNPLVSGLGTLPLQPPSIHKLRQHRPLGRTQSAPLPQNAQALQQLVVQQQHQQFLE
KHKQQFQQQQLHMSKMMAKPSEPGRQHESHPEETEEELREHQALTDPAEGLPRGVTIKQE
PPDELEEELQQRERQAEQELLFRQQALLLEQQRIHQLRNYQASMEAAGLSVTFPGHRPLS
RAQSSPASATFPIVVQEPPTKPRFTTGLVYDTLMQKHQCMCGNTNTHPEHAGRIQSIWSR
LQETGLRGKCECIRGRKATLEELQTVHSEAHVMLYGTNPLRQKLDSSVTPMFVRLPCGGI
GVDSDTIWNEVHSSSAARLAVGSVVELVFKVASGELKNGFAVVRPPGHHAEESTPMGFCY
FNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYSDPNILYLSLHRYDDGNFFPGS
GAPDEVGSGPGLGFNVNMAFTGGLEPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFD
AVEGHASPLGGYRLTAKCFGYLTKQLMGLAGGRLVLALEGGHDLTAICDASEACVSALLG
NELEPLSDEVLQQRPNLNAVRSIEKVLESHSKYWRCLQRGASTLGYSLVEAQKCETEEAE
TVTAMASLSVAAKHMGKRSEEEPMEEEPPL
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccacagtcaccaagatggccttcctagcaaagagcagccactggagcttctg
aagccatctggactcaaccacattccctctgttgatgtgagtgcagctctgcccattccc
gtgcccccggctgccatcccgatggatctgcgcgtggaccaccagcagcagaagcacttg
tcgctggcgtcagtggaaccagctccgcgtgagcagcagctgcagcaggagctcctggcc
ctcaagcagaagcagcagatccagcggcagctgctcatcgccgagttccagagacagcac
gagcagctctctcgccagcatgaggcccaactacaggagcatgtcaagcatcagcaggag
ctgctggctctgaagcatcagcaggagcttctggagcaccagaggaagttggagcggcac
cggcgcgagcaggagctggagaaacagcagcgcgagcagaagctacatcagctcaagaac
aaggagcgcggccaagagagtgcggtggccagtacggaggtgaagatgcgtctgcaggag
ttcgtgctgaataagaagaaagctctggtccagaggagcctcaaccactgcatgcccagt
gaccctcgctactggtatgggaaaacccagcacagttcactggaccagagttctccacct
cagacagggatttccacttataaccacccggtgctgggcctctacgactctaaagacgac
ttcccgctccgcaagacagcgtctgagccaaacctgaagctacgctccagactgaagcag
aaggtgacggagcggcggagcagcccactactgcggaggagggaggggccgatcaccacg
gctaagaaacgctcactggacatggcagaatcggcgtgtaacagtgctcctgggtccgga
ccgagctcacccaacaacagctccaacaatatcactaacgagaacggcattgctgggtcc
atctccaacagtccggtagagccgtctctggcacaccggctagctggcagggagggtcct
gtaagccatttgtccctgtacacatcaccctccctcccaaacatcaccctgggtctgcca
gcccccagctcatcaagcgtggcatctggtcagcaggaaggtgaacggctggcgatggcg
aacctgcagcctggattatccttaaccactcccttcatccccggagcccacctgcctaca
tacctggctgcctccgctctagagcgggagggaggctccgcccacaacccgctgctgcag
cacatggtctcccagaaccctctggtgtcaggcctgggtactctgcccctgcagcctccc
tccatccataaactgcggcagcaccggccactgggccgaacgcagtccgcgccgctcccc
cagaacgcccaggctctgcagcagctcgtggtccagcagcagcaccagcagttcctggag
aaacacaaacagcagttccagcagcagcaacttcatatgagcaagatgatggctaagccc
agtgagccgggccggcagcacgaatctcatcctgaggagacggaagaggagctcagagag
caccaggccctgaccgacccggccgagggcctaccccgaggggttaccatcaaacaggag
ccccctgacgaactggaggaggagctccagcagagagagagacaggctgagcaagagctg
ctcttcagacagcaggctctcctgctggagcagcagaggatccatcagctgaggaactat
caggcgtcaatggaggccgccggcctgtccgtcacgttccccggacaccgcccactgtcc
agagcacagtcgtccccggcctcagccaccttccctatcgtggtgcaggagccaccaacc
aaaccacgcttcaccaccgggctggtgtatgacactttaatgcagaagcatcagtgtatg
tgcggtaacaccaacacccacccggagcatgcaggccgcatccagagcatctggtccaga
ctgcaggagaccggactgcgcggcaagtgtgagtgtattcggggcaggaaagccacactg
gaggaactgcagacggtccactctgaagctcatgtaatgctgtatggaactaacccacta
agacagaaactagacagttctgtgacacccatgttcgtgaggttgccctgtggggggatt
ggggtggatagtgacactatctggaatgaggtccactcgtctagcgcagcccgcctggct
gtcggctctgtggtggagctggtatttaaagtggcatccggagagctaaagaatggcttt
gctgtggttcggcctccaggacaccacgctgaggagagcaccccaatgggattctgctat
ttcaactctgtggccatcgcagccaagcttctgcagcagcggctgaacgtcagcaagatc
ctgatagtggactgggatgttcatcatggcaacgggacccaacaggctttctacagcgac
cccaacatcttatacctttctctccatcgctacgatgacgggaacttcttccctggcagt
ggagctcccgatgaggtgggctcgggacctggccttggcttcaacgtgaacatggccttc
accggtggcctggaacctcccatgggcgacgcagagtatctggctgccttcagaacggtg
gtgatgcccatcgctaatgagtttgctcccgacgtggtgctggtttcgtcggggttcgac
gcagtggagggccacgcttcgccacttggaggatacagactcacggccaagtgttttggc
tacctgaccaagcagctgatgggcctggccggcggccgcctggtgctcgccctggagggg
ggtcatgacctcactgccatttgcgatgcgtctgaagcatgtgtttctgctttactagga
aacgagctggagccactttctgatgaggttctgcagcaaaggcccaatctcaatgctgtg
cgctccatagagaaagttctggaatcacatagtaagtactggcgctgtctgcagcgcggt
gcttcgacgctgggctactctcttgttgaagctcagaagtgtgagacagaggaggccgag
actgtgaccgccatggcctctctgtctgtagctgccaaacacatggggaagaggtccgag
gaggagccgatggaggaagagccgccactgtag

DBGET integrated database retrieval system