KEGG   Astyanax mexicanus (Mexican tetra): 103030485
Entry
103030485         CDS       T05042                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04012  ErbB signaling pathway
amex04068  FoxO signaling pathway
amex04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103030485
   04068 FoxO signaling pathway
    103030485
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103030485
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103030485
NCBI-ProteinID: XP_007232337
Ensembl: ENSAMXG00000004092
LinkDB
Position
7
AA seq 204 aa
MSDVRLSNGSPPLERVDARLADHTRLPVRRNLFGGGAAPDSAEFRRDCTEQLREQERALR
DKYNFDFARDEPLAPGQFVWEAMDGRSVPDFYSRPPRGSEPGRSGRRAPRRSSPSPSPSP
PNQSEEDVDGGGGSDGGGGGGGAGVRTERTAARSDCRGVTRKRRSTEQQDGASQSKRVNG
NSDAEEANHCPPEQTPRKSPPPNT
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtccgatgtgcgcctgtctaacggaagccccccgctggagagggtggacgcgaggctc
gcggaccacacgaggctcccggtgcgcaggaacctgtttggcggcggagctgcaccggac
tcggcggagttccggcgggactgcaccgagcagctgcgggagcaggagcgcgctttgcgg
gacaagtacaacttcgacttcgcgcgggacgagccgctcgcccccgggcagtttgtgtgg
gaggcgatggacgggaggagtgtgccggacttttacagcaggccgccgcgcggatcagag
cccgggcggagcggacggagagctccgaggcgcagcagcccgagcccgagtccgagtccg
cctaaccagagcgaggaggacgtagacggaggcggtggcagtgatggtggtggaggtggt
ggaggtgcgggagtgcgcacggagcgcacggctgcgcgctcggactgcaggggggtaacg
aggaaaagacgctccacggagcagcaggatggagccagtcagagtaaaagagtgaacggg
aacagtgatgcggaggaagccaaccactgtccaccagagcagacccccagaaaatcacct
cctcccaacacgtaa

DBGET integrated database retrieval system