KEGG   Astyanax mexicanus (Mexican tetra): 103031000
Entry
103031000         CDS       T05042                                 

Definition
(RefSeq) signal transducer and activator of transcription 1-like
  KO
K11220  signal transducer and activator of transcription 1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04217  Necroptosis
amex04620  Toll-like receptor signaling pathway
amex04621  NOD-like receptor signaling pathway
amex04625  C-type lectin receptor signaling pathway
amex05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:amex00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103031000
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103031000
   04621 NOD-like receptor signaling pathway
    103031000
   04625 C-type lectin receptor signaling pathway
    103031000
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103031000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103031000
Transcription factors [BR:amex03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103031000
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 DUF4407
Other DBs
NCBI-GeneID: 103031000
NCBI-ProteinID: XP_022535811
LinkDB
Position
19
AA seq 745 aa
MALWHQLQQLDSRYLEQVDQLYDEAFPMEIRQYLSQWIESQDWDAAAADVSLATLRFHEL
LTKLDEHHSRINQGNNFLLLHNIRKIKRNLQMFFQEYPMQMAMIISNLLNEERKILEMAL
KTQEKAGSSQSNVMMDKQKQLDIQVNDLKKKVQEAEQEIQALEDLQDEHDFKKKTLQSSQ
MEVEMNAQAAKEIKDEELRIKEMFLRLNQMREVVIYELVNALKLVEQIEFTLISVELPEW
KQRQQMACIGGPPNACLDQLQSWFTTVAECLQQIRQQLNKLNELQLKFTYDNDPISLSMS
SLQEQALKLFKDLLVNSMVVERQPCMPTHPQRPLVLKTGVQFTVKIRLLVKLHELNCQLK
VKASFDKDLPEKTSFKGYNILGTNSKVMNMEESSGCLAAEFRHLQLKEQKSVGTKSNKVP
LLVTEELHSISFETHLSQLGLSIDLKTTSLPVVAISHINQMQNAWASILWYNMLCTDCQN
LTFFLNPPMVKWGELSKVLSWQFSSVTKRGLSADQLSVLGNRLLGAEANGDPEALITWNK
FSKSTADRGIVFWLWLDSILDLIKRCLLNIWNDGHIIGFISKEKVKALLWDKRPGTFLLR
FSETCKEGGITFTWVEQTQNGEPQTHSVEPYTKADLNDLSFPDVIRDYTLMASENIPENP
LLYLYPDIPKDVALGCYYSNPDDDSEAMDVDRPYPYLKRQKIMVSRFPHTRRQDSMLLLN
EEEYDEVEKQNKESGMHTLCSTLPH
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggcactttggcaccagctacagcagctggattccagatatctggagcaagtggaccag
ctctatgatgaagccttccccatggaaatccgacagtacctcagccagtggatagagagc
caagactgggatgctgcagctgcggacgtgtcgttagctacactgcgtttccatgagctc
ctgacaaagctggacgagcaccacagtcgaataaatcagggcaacaacttcctgcttcta
cataacatccggaagataaaacgcaatctacagatgttcttccaggagtatccaatgcaa
atggcaatgatcatatccaatttactgaatgaagagaggaagattctggagatggccctc
aaaacacaggagaaggctggatcatcacagagcaatgttatgatggacaaacaaaagcag
ctggacatccaagtgaacgacctgaagaagaaagttcaggaagcagaacaggaaattcag
gctctggaggatctacaagacgagcacgacttcaagaagaaaaccttgcaaagtagtcaa
atggaggttgaaatgaatgcacaggcagcaaaagagatcaaggatgaggagttgaggatc
aaggagatgtttctaagactaaaccaaatgagagaggtggtcatatatgagttagtaaat
gccctgaagttagtggagcagattgaattcactctaatatcagtggagctgcctgaatgg
aagcagaggcagcagatggcctgcattggaggaccaccaaacgcctgtctggaccagtta
cagagctggttcacaacagtagcagagtgtcttcagcagatccggcagcagctgaacaaa
ctcaacgaactgcagctaaaattcacgtacgacaacgaccccatcagcctgagcatgagt
tctctgcaggaacaggccctgaagctcttcaaagacttgctggtgaattccatggtggtg
gagaggcagccctgcatgcccacccatccgcaaagacccctggtgctgaagaccggcgtg
cagttcacagtcaagatcaggctgcttgtcaagctacatgagctgaactgccaactcaaa
gtcaaagcctcctttgacaaggatttgccagagaaaacctcattcaaaggatacaatatt
ttgggcacaaactcgaaggtcatgaacatggaggaatccagcggttgcttggctgctgaa
ttcagacatttgcaactgaaagagcaaaagagtgtgggaacaaaaagcaataaggtccct
ctcctcgttacagaggagctccattccatcagctttgaaacacatctcagtcagcttgga
ttatccattgatttaaagaccacctcacttcctgtagtagccatctctcatatcaaccag
atgcagaatgcctgggcctccatcctgtggtataacatgctctgcactgactgtcagaat
ctgactttttttctgaaccctccaatggtaaagtggggtgaactgtcgaaggtcctgagc
tggcagttttcctcggtcactaagagaggcctcagcgcagaccaactgagcgtgctcggc
aacagactgctaggtgctgaggctaacggagatcctgaagcactaatcacctggaataag
ttcagtaagtctactgctgacaggggaattgtgttctggttgtggttagactcgatactg
gaccttattaaacgatgcctactcaacatctggaatgatgggcatatcattggcttcatt
agtaaggagaaggtgaaggctctgctgtgggataaacgtcccggcactttcctgctgcgc
ttcagtgagacgtgtaaagaaggaggaatcaccttcacgtgggtggagcagacacaaaac
ggtgagccgcagacacactctgtcgagccctacactaaagcggatcttaatgatctaagt
ttccctgatgtcatccgggactacacactaatggctagtgagaacattccagagaaccct
ctgctctacctgtacccagacattcccaaggacgttgctctcggatgttactacagcaat
ccagacgacgattcagaagccatggatgtggatagaccatatccctatttgaaaagacaa
aagatcatggtgtcacgttttccacacacaagacgtcaggacagcatgctgcttctgaat
gaagaagagtatgatgaggttgagaagcaaaacaaagaaagtggaatgcacacattgtgt
tctactttaccacactga

DBGET integrated database retrieval system