KEGG   Astyanax mexicanus (Mexican tetra): 103031322
Entry
103031322         CDS       T05042                                 

Gene name
stat4
Definition
(RefSeq) signal transducer and activator of transcription 4 isoform X1
  KO
K11222  signal transducer and activator of transcription 4
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103031322 (stat4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103031322 (stat4)
Transcription factors [BR:amex03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103031322 (stat4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 MutS_III TRPM_tetra
Other DBs
NCBI-GeneID: 103031322
NCBI-ProteinID: XP_022535804
Ensembl: ENSAMXG00000003205
LinkDB
Position
19
AA seq 748 aa
MSQWKQIQQLDMKFLEQVDFFYDDNFPMELRQVLANWIESQDWETATNHEAMATVLFNNF
LLQLERHCTQEQNFLHRHNLKRIFQQIQQRYKANPQNLSAVISNCLREERRIISAASMQE
QGPLEKSMQNSAALEKQKNLDNRVAVIRSSVQLLDQAVKHLEDMQDDFDFRYKTLQLRDP
AERNSQNMKQEVMALQEILNHLDYKRKEILSKMADVIKEIDAMVASQLMPELQEWKRRQQ
IASIGGPVLTGLDQLQNWFTMTAQSLFQIKRQLDKLGELIVKVTYESDPIPQQRPQMEEQ
VKYLIYHLIKSSFVVEKQPCMPTHPQKPLIIKTQVQFTTKVRLLVKLPEVDYQLKVKTTF
DKDLQSGKVTRQFFIPTNNTKVMDVEESSNGCLSVEFRHLQLKEKKCMSGAKGNEGPLTV
TEELHSLSFEAMLCLQGLDIDLETCSLPLVVISNVSQLPAGWASVMWYNLLTDEPKNLAF
FSNPPRASWSQLSEVLSWQFSSFAGRGLNKEQLSMLGDKLLGQHVSYNDSQVSWSKFCKE
NIPGKSFNFWLWLDSILELIKKHLLPVWIDGYIMGFVSKEMERALLKDREPGTFLLRFSE
SHLGGITFTWVEQENGEAKFISVEPYTKNRLSALAIADIIRDYKVIADGIVPENPLKFLY
PDIPKDEAFGKHYNNQPNKVCPYIQTILIPVSVKWTFDLHWNNIKRWSTTPPPCSSPEPP
LSPGMSSMLSEQISAYEIESVVSLLSSP
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgagccagtggaagcaaatccagcagctggacatgaagttcctggagcaggtggacttc
ttttatgatgataactttcccatggagctgagacaagtgctggccaactggattgaaagc
caggactgggaaacagccacaaaccacgaggccatggctacagtgctctttaacaacttc
ctgctacagctggagaggcactgcacccaggaacagaactttctgcacagacacaacctg
aagagaatattccaacagatccagcaacgatacaaagccaaccctcagaatctgtctgca
gtcatctccaactgtctgagagaagagcgacgcatcatatctgccgccagcatgcaggag
cagggtccgctggagaagtctatgcaaaactcagcagctttggagaagcagaaaaacctg
gacaacagagtggctgtgattcgcagtagcgtgcagcttctggaccaggcagtgaagcat
ctggaagacatgcaggatgattttgattttcgctataaaaccctccagcttcgggaccca
gcggagaggaactctcagaatatgaaacaagaagtcatggcgcttcaggaaatactcaac
catctagactataaaaggaaggagattttatccaagatggcagacgtgataaaggagata
gatgcgatggttgcctctcagctaatgccagagctgcaggagtggaaacgtaggcagcag
attgcgagcatcggaggccctgtcctaaccggcctcgaccagctacagaactggttcacc
atgactgcccagagtttgttccagattaaacgacagctggataaactgggcgagctcatc
gtgaaggtgacctacgagagtgaccccatcccgcagcagagacctcagatggaggaacaa
gtcaaatatctcatataccatctcatcaaaagttcctttgtggtggagaagcagccatgc
atgccaacacacccacagaaaccccttatcatcaagacacaagtacagttcaccaccaaa
gtcagattgctggttaagctaccggaagtagactatcagcttaaagtgaagacaacattt
gacaaggacctccaaagcggcaaagtaacaagacagttcttcatccccacaaacaacacc
aaagtgatggatgtggaggagtcctccaatggatgcttatcagtggagttcagacatctg
cagctgaaagagaagaaatgcatgagtggagcaaaaggaaatgagggtccgctaacagtg
acagaagaactgcactccctcagttttgaggccatgctgtgtttgcagggactggacatt
gacctggagacctgctccctgcccttggtggtaatctccaatgtaagccagcttccagca
ggctgggcttcagtcatgtggtacaacctgctgacagatgagcccaagaacctggcgttc
ttcagtaacccgccgagggcgagttggagtcagctgtccgaggtgctgagctggcagttc
tccagttttgctggacgaggactcaataaggagcagctgagcatgctgggagataaactt
ctaggtcaacatgtatcttataacgacagccaggtatcttggtctaagttctgcaaggaa
aacattccagggaaatcattcaacttctggctgtggctggactctattctggagctcatt
aagaaacacttgcttcctgtttggattgatggctacatcatgggctttgtgagtaaggag
atggagcgagctctgctgaaggacagggagccgggcaccttcctactgcgcttcagtgaa
agtcacctgggaggaatcactttcacctgggtggagcaggaaaatggagaagcaaagttc
atctctgtggaaccgtacaccaagaaccgtctcagtgcccttgccattgctgatatcata
cgggactataaagtaatagcagacggcatcgtccctgagaacccactaaagttcctttac
cctgacattcccaaggacgaagcattcgggaaacattataacaatcagccaaacaaagtt
tgtccctacatacaaacaattttgattcctgtctcagtgaaatggacatttgatcttcat
tggaacaatattaagagatggagcaccactcctcctccctgctcctctccagagccccct
ctgtccccaggaatgtccagcatgctcagcgagcagatcagtgcctatgagattgaaagt
gttgtaagtctgctttcttctccctag

DBGET integrated database retrieval system