KEGG   Astyanax mexicanus (Mexican tetra): 103031341Help
Entry
103031341         CDS       T05042                                 

Gene name
sdhb
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00020  Citrate cycle (TCA cycle)
amex00190  Oxidative phosphorylation
amex01100  Metabolic pathways
amex01200  Carbon metabolism
Module
amex_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103031341 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103031341 (sdhb)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103031341 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 103031341
NCBI-ProteinID: XP_022538244
LinkDB All DBs
Position
22
AA seq 284 aa AA seqDB search
MAALCVCSARQGAAALRSSSGLLALRYVQTAAAAAPAVQPRIKKFQIYRWDPDTPGDKPC
MQTYEVDLNACGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACLNKI
DTNISKVSKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKQGKEQYLQTVEDR
QKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLSKLQDP
FSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKAATA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgtgtgtgtgctcggctcggcagggcgctgcggctctccgctcttcctcc
ggcctgctggctttgcggtatgtccagaccgctgcagctgcggctccggcggttcagccg
cggattaagaagttccagatttaccgctgggacccggacacacccggagacaaaccctgc
atgcagacctacgaggtcgacctcaacgcctgtgggccaatggtgctggatgctctgatt
aaaatcaagaatgagatggactctaccctcaccttcagacgctcctgcagagaaggtatc
tgtggatcttgtgcaatgaacattaatggtgggaacacgttggcctgcctcaacaaaatt
gacaccaacatcagcaaagtgtccaagatttacccccttccacacatgtatgtggttaaa
gacctggtgccggacatgagtaacttctacgctcagtataagtccattgagccgtacctg
aagaagaaggatgagagtaagcaggggaaggagcagtatctgcagactgtggaagaccga
cagaaactggatggtctgtacgagtgtatcctgtgtgcgtgctgcagtaccagctgtcca
agttactggtggaatggagacaaatacctgggacctgcagttctcatgcaggcgtatcgg
tggatgatagactcgcgtgatgattacacagaggagagactgtccaaactgcaggatccg
ttctctctgtaccgctgtcacacaatcatgaactgcaccagaacctgcccaaagggtctg
aatccggggaaggccatcgcagagataaagaagatgatggccacgtataaagagaagaaa
gcagccactgcgtga

DBGET integrated database retrieval system