KEGG   Astyanax mexicanus (Mexican tetra): 103031397
Entry
103031397         CDS       T05042                                 

Gene name
ccnd2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04068  FoxO signaling pathway
amex04110  Cell cycle
amex04115  p53 signaling pathway
amex04218  Cellular senescence
amex04310  Wnt signaling pathway
amex04340  Hedgehog signaling pathway
amex04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103031397 (ccnd2)
   04340 Hedgehog signaling pathway
    103031397 (ccnd2)
   04068 FoxO signaling pathway
    103031397 (ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103031397 (ccnd2)
   04115 p53 signaling pathway
    103031397 (ccnd2)
   04218 Cellular senescence
    103031397 (ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103031397 (ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C Herp-Cyclin
Other DBs
NCBI-GeneID: 103031397
NCBI-ProteinID: XP_007228423
Ensembl: ENSAMXG00000013158
LinkDB
Position
24
AA seq 297 aa
MELYCLEAEPMVRAHPDPNLLSDDRVLQSLLTIEERFLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLSVVPTRKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPHELLEWELVVLGKLKWNLAAVTPNDFIEHIVKKLPLPEDKLDVIRKH
VQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLNSTDRSLWGDNLAELLAKITNTEV
DVLKACQEQIERVLMNSLREGRRQQHKQQQQDQGSRNKALDDQDQSSTPTDVRDINL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagctttactgcctcgaggcagagccgatggtcagagcccatccggaccccaacctg
ctgtccgacgaccgggtcctgcagagcctgctgaccatcgaggagcggttcttgccccag
tgctcttacttcaagtgcgtgcagaaggacatccagcccttcatgcggaggatggtggct
acctggatgctggaggtgtgtgaggagcagaagtgtgaggaggaggtcttccccctggcc
atgaactacctggaccgtttcctgtccgtggttccgacccgaaagtgtaacctgcagctg
ctgggcgctgtctgcatgttcctggcctccaagctgaaggaaacgcggccgctcaccgcc
gagaagctctgcatctacaccgacaactccattagacctcatgagctgctggaatgggag
ctggtggtgctgggaaagttgaagtggaacctggctgctgtgactcctaacgacttcatc
gagcacatcgtgaaaaagctgccgctgcctgaggacaagttggacgtgatccgcaagcat
gtgcagaccttcatcgccttgtgcgcaacagatttcaactttgccatgtaccctccatcc
atgatcgccacaggcagcgtgggagcagcaatctgcggcctacagctcaacagcacggac
cgttcgctgtggggggacaaccttgcagaactgcttgccaagatcacaaacacagaagtt
gacgtgttgaaggcgtgtcaggagcagatcgagcgcgtgctgatgaacagtctgagggag
ggccgccggcagcagcacaagcagcagcagcaagatcaaggatcacgtaacaaagcgctg
gacgaccaggaccagtccagtacccccaccgacgtacgggacatcaacttatga

KEGG   Astyanax mexicanus (Mexican tetra): 103031956
Entry
103031956         CDS       T05042                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04068  FoxO signaling pathway
amex04110  Cell cycle
amex04115  p53 signaling pathway
amex04218  Cellular senescence
amex04310  Wnt signaling pathway
amex04340  Hedgehog signaling pathway
amex04371  Apelin signaling pathway
amex04510  Focal adhesion
amex04530  Tight junction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103031956 (ccnd1)
   04340 Hedgehog signaling pathway
    103031956 (ccnd1)
   04371 Apelin signaling pathway
    103031956 (ccnd1)
   04068 FoxO signaling pathway
    103031956 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103031956 (ccnd1)
   04115 p53 signaling pathway
    103031956 (ccnd1)
   04218 Cellular senescence
    103031956 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103031956 (ccnd1)
   04530 Tight junction
    103031956 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103031956
NCBI-ProteinID: XP_007254687
Ensembl: ENSAMXG00000009707
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVDAVRRAYHDTNLLNDRVLQTMLRAEETYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKSRLQLLGAACMFLASKMKETVPLT
AEKLCIYTDNSIRPCELLQMELLALNKLKWDLASVTPHDFIEHFLTKLQIHQGTKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKNSDSSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSISTETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcaccagctgctgtgctgcgaggtggacgccgtgcggagagcctaccacgacacg
aacctgctgaacgaccgagttttacagaccatgctgagggctgaagagacctacctcccc
tctccaaactacttcaagtgcgttcagaaggaaatcgtgcctaaaatgaggaaaatcgtc
gccacatggatgctggaggtgtgtgaagagcagaaatgtgaagaggaggtttttcccttg
gctatgaactacctggacagattcttgtctgtggagcccactaagaagagcaggctgcag
ttgcttggagctgcctgcatgttcctggcctccaagatgaaggaaaccgttcctctcaca
gctgagaagctctgcatatacacagacaactctattcgtccatgcgagctcttgcaaatg
gagctgctggcgctgaacaagctgaagtgggatctagcctcagtgacaccacacgacttc
attgaacatttcctcaccaagctgcagatacaccagggcaccaagcagatcctgcgcaag
catgcccagacgttcgtggctctatgtgcaacagacgtcaacttcattgcaagccctccc
tccatgatcgcggcaggcagcgtggctgcagcggtgcaagggctttacttgaagaacagc
gacagctctctctcctcccagaacctcaccaacttcctctcgcaggtcatcagaagtgac
ccggactgtctgcggtcatgccaggagcagatcgagtcactgctggagtccagtctgaga
caggctcagcagcacagcatctccacagaaaccaaacgagtggaggaggacgtggacctc
tcatgcactcccacagacgtcagggacattaacatctga

KEGG   Astyanax mexicanus (Mexican tetra): 103045792
Entry
103045792         CDS       T05042                                 

Gene name
ccnd3
Definition
(RefSeq) LOW QUALITY PROTEIN: G1/S-specific cyclin-D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04110  Cell cycle
amex04115  p53 signaling pathway
amex04218  Cellular senescence
amex04310  Wnt signaling pathway
amex04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103045792 (ccnd3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103045792 (ccnd3)
   04115 p53 signaling pathway
    103045792 (ccnd3)
   04218 Cellular senescence
    103045792 (ccnd3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103045792 (ccnd3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103045792
NCBI-ProteinID: XP_022538233
Ensembl: ENSAMXG00000008787
LinkDB
Position
22
AA seq 294 aa
MELTCYENNEFLSSSEPPTPCGPVRAYSDPVLTRDNRAWRNMQVSEKADPPSGSYFGTVQ
TSVRPSMRRILAVWMLQVCEEQRCEEEVFPLAVRYLDRYMSLHPVDTHGLQLLGTVCMFL
ASKLREAVPLSATKLCIYTDNSVSLSQLLQWEILVVSRLNWNLALVVPSDFLEPLLHGLP
IIPHNLPALRXHVHSYIALSATEFTFSTYLPSIIACSCVAAAILRLNLLDGALSRNTLLQ
LMANILEVDLDSLHNCYAALETTLDLNLPHLPNIEVTCRKGSPGTEVTNTPVNV
NT seq 885 nt   +upstreamnt  +downstreamnt
atggagttaacctgttacgaaaataacgagtttttgagcagctcggaacctcccacaccc
tgcgggccggttcgggcctattccgacccggttctgacccgggataaccgggcctggagg
aacatgcaggtctcggagaaagccgaccctccctcagggtcttatttcggtaccgtacag
accagcgtacggcccagcatgcggagaatattagcggtgtggatgctgcaggtgtgtgag
gagcagcgctgcgaggaggaagtgtttccattggccgttcgctatctggacaggtacatg
tccctccaccccgtggacacacacggcctgcagctgctcgggaccgtctgcatgttcctg
gcctccaaactcagagaagccgttccgctgagtgccaccaaactgtgtatctacaccgac
aactctgtctccctgtcgcagctgctgcagtgggagattttggtggtgtcccgtctgaac
tggaacctggccctagtggtgccttctgatttcctagaacctctattgcacggactaccc
ataattcctcacaacctgccagctctgcgcnaacacgtccactcgtacattgcactctct
gcaacagagttcacattttcgacgtacctgccttccattattgcctgtagctgtgtggct
gctgctattctccgtctcaatctgctggatggagctctatccaggaatacacttttgcag
ctaatggctaatatcctggaagtggacctggactctctgcataactgctatgctgcattg
gaaaccactttagaccttaacctgccccacctccccaacattgaagtcacctgcaggaaa
ggatcacctggcactgaggtcacaaacacacctgtaaatgtttag

KEGG   Astyanax mexicanus (Mexican tetra): 111193357
Entry
111193357         CDS       T05042                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04068  FoxO signaling pathway
amex04110  Cell cycle
amex04115  p53 signaling pathway
amex04218  Cellular senescence
amex04310  Wnt signaling pathway
amex04340  Hedgehog signaling pathway
amex04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111193357
   04340 Hedgehog signaling pathway
    111193357
   04068 FoxO signaling pathway
    111193357
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111193357
   04115 p53 signaling pathway
    111193357
   04218 Cellular senescence
    111193357
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111193357
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C CRT10
Other DBs
NCBI-GeneID: 111193357
NCBI-ProteinID: XP_022529589
LinkDB
Position
2
AA seq 300 aa
MSVSLWCEEEEDVQPVGHRESASVRAPRDPNASGLRVIHGLLRSQDRYLPSPLYTSLIQR
DPKRREELAKWTLEVCCDCGSDESVFPLSVSLLDRYLSVTLALPASPYCLAAACILVASK
LVESEPVSADTLCAAAEYEFMSSNLREMERVLLGTLRWDVAAVTPQDFIPHFLSCLEELE
GDNTERDFISTLRRHSDTLTAMCVCDSRFLGTPASLVSAAAINSAIRGLESKSQREMSHM
TFTLAALCQTDVAVLQCYSELIEDALSERLRSSQEEEEQKEGGMEDERSSTPTDLREIDF
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtctgtgtctctgtggtgtgaggaggaggaggatgttcagcctgttggtcacagagaa
tcagcttcagtccgagccccccgagaccccaacgcttccggcctgagagtcatccacggc
ctcctgcgctcgcaagacagatacctcccctctccactctacacctcactcatccagaga
gaccccaaacgcagagaggaactggccaagtggaccctggaggtgtgctgtgactgtggc
agtgatgagtctgtgtttccgctgtctgtctctctgctggaccgttatctgtctgtgacg
ctggctctgccggcctctccgtactgcctggccgctgcctgtatcctggtggcctctaag
ttggtggagagtgagccggtcagtgcagacactctgtgtgctgcggccgagtacgagttc
atgtcctcaaacctcagggagatggagcgtgtgctgctgggaactctaaggtgggacgta
gctgcagtgacccctcaggacttcatccctcacttcttatcctgcctggaggagctggag
ggagacaacacagagagagacttcatctccaccctcagacgacacagcgacactctgacg
gccatgtgtgtgtgtgactctcgctttctgggcactccggcctctctggtgtctgcagcg
gccatcaactcagccatccggggactagagtcgaaaagccagagagaaatgagtcacatg
accttcaccctggctgcgctctgtcagactgatgtggccgtgctgcagtgctacagtgag
ctgatagaggatgctctcagtgagagactgagatccagccaggaggaggaggagcagaaa
gaaggagggatggaggacgaaaggtcgagcacacccaccgacctgagagagatagacttt
taa

DBGET integrated database retrieval system