KEGG   Astyanax mexicanus (Mexican tetra): 103031559
Entry
103031559         CDS       T05042                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04141  Protein processing in endoplasmic reticulum
amex04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:amex00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103031559
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103031559
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103031559
Transcription factors [BR:amex03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103031559
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA DUF2756 CENP-H
Other DBs
NCBI-GeneID: 103031559
NCBI-ProteinID: XP_022519696
Ensembl: ENSAMXG00000005083
LinkDB
Position
Unknown
AA seq 685 aa
MTADLLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEEGDFSRGLKYDTSLDTDLVLTL
DPDNPTSPWKHLEDNLLSGNMPMIKDEMTITQPLPVDMLFQVKAEPPSPSSSPSSESSMS
SLPEPQVLVKGENPPTPPYMYGDVLSPPLATMEVTVATTVPPQPQTAVLPSPTVISSAAT
LKASSILSTKPLLQPRPVCVATVPQSSSPAKALILQSLPVSVPSIDQSRAPRLVCLGSAP
AIVKMEPVSPSISHCSSPTAPPTTTNTKPIIPASSLPGSNCNDIDMKVLKRQQRMIKNRE
SACQSRKKKKEYLQNLETQLREAQQENERLRRENQQLRLRLAGKEGGESGNNKRAVCVMV
VLLFITFSFAPVSITDRKLDSVLEEGAGPHTGRHLLVYEKSPEPGRGGASEGVMEERIES
EEEGGEERWRGAEMERESAETFHFRNVSSVFSEVKDLVLQDIDRLFSSSDCRQFNRSESL
RLADELRGWVHRHQIDRKKSGGGGKAKIAQKAKIAQKAQHKKTNFSRYLPIEAHRSIESQ
LQLLPGPEVSYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKMSLVMPAMAVN
ESVYNSSQGGYELMMQVDCEVMDTRIIPIKSSAVPPSLRDPPPARSSHHHHANHTRQHHA
TPSSRQPLPVRRRGAEFLISQSGSD
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgaccgccgacctgctgtctgatctggacagtcgattcttcgccgataatctgctcacg
agcgaagactgggatgcctgtctgtatcagtgtgagagtatggaggagggtgaggagggg
gacttcagcagggggctgaaatacgacacatcgctggatactgacctggtgttgaccctt
gaccctgacaaccccacgtcaccatggaaacacctggaagacaacctgctctcaggtaac
atgcccatgataaaagatgaaatgacgataacacagccgctcccagtggacatgttgttt
caggtgaaggcggagcctccatcaccgtcctcctctccatcctcagagagctccatgtcc
tccttacctgaaccccaggttctggtgaaaggtgagaatccccccacgcctccatatatg
tatggagacgttctgtcgccccctctggctactatggaggttacagtggccactacagtc
cctcctcagcctcagacagcggtgctaccttcacctacagtgatctcgtcggcggctacg
ctaaaggctagctctatcctcagcactaagccgttgctgcagccgcggccggtgtgtgta
gccaccgttcctcagtcctccagtccggctaaagctctgatcctgcagagcctcccagta
tccgtccccagtatcgaccagagccgcgccccccgtctggtgtgtttgggttctgctcct
gctatcgttaaaatggaaccagtatctcccagcatcagccactgcagcagccccacggcc
ccgcccaccaccaccaacaccaagcccatcatcccagcatcctctctgcccggcagcaac
tgcaacgacatcgacatgaaggttctgaagcggcagcagcggatgataaagaaccgggag
tcggcgtgtcagagccggaagaagaagaaggagtacctgcagaacctggagacccaactc
agagaagctcagcaggagaacgagagactccgccgagagaaccagcagctccgcctacga
ctcgccgggaaagagggtggtgaatctggtaataataagagagcggtgtgtgtgatggtg
gtcctgctcttcatcaccttcagcttcgctccagtcagcatcacagacaggaagctggac
tcagtgctggaagaaggggcggggcctcacacaggaagacacctgctggtgtatgagaag
agtccggagccggggcggggcggggcgagcgagggagtgatggaggagaggatagagagt
gaggaggagggaggagaggagaggtggaggggagcagagatggagagagagagcgcagaa
acctttcacttcaggaatgtgagcagtgtgttcagtgaggtgaaggatctggtcctgcag
gacatcgaccggctcttctcctcctcagactgcagacagttcaaccgctcagagtccctc
aggctggctgatgagctacgtggctgggtgcatcgtcatcagatcgacaggaagaagtct
ggtggtggtgggaaggcgaagatcgctcagaaagcaaaaatagctcagaaagcacagcac
aaaaagactaacttctccaggtatctccccatcgaggctcaccgttccatcgagagtcag
ctgcagctgttgcccggaccggaggtcagctacagcgacttcctggacgcgatcgaccgg
agagaggacacgttttacgtggtgtccttcagacgggatcatctgctgcttcctgctata
agccacaataaaaccacacggcccaagatgtccctcgtcatgccagcgatggccgtcaac
gagtcggtgtataactcgtctcagggagggtatgagctgatgatgcaggtggattgtgag
gtgatggacaccagaatcatccctattaaatcctccgcggtcccgccctccctcagagat
ccgcccccggcccgctcctctcatcatcaccatgccaaccacacacggcaacaccacgcc
acgccgtcgtcacgccaaccgcttcctgtacggaggaggggggcggagtttctgatcagc
caatcagggtcagactga

DBGET integrated database retrieval system