KEGG   Astyanax mexicanus (Mexican tetra): 103031828
Entry
103031828         CDS       T05042                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X2
  KO
K05437  erythropoietin
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103031828 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amex04052]
    103031828 (epo)
Cytokines and growth factors [BR:amex04052]
 Cytokines
  CSF and other factors
   103031828 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103031828
NCBI-ProteinID: XP_007250217
Ensembl: ENSAMXG00000003347
LinkDB
Position
16
AA seq 183 aa
MFRSSGLFALLLIVLEWTRPGLPSPLRPICDLRVLDHFIKEARDAEATMRVCKEDCSIGV
PLMVPLTRVDIGVWEKKNMAEQAQEVQTGLWLLNRAFISLHTSISNSALHSHIDASVRNI
ASIGQVLRSLSIQDYVPTVSGIDLQETWQVSSAPELFQVHINFLRGKVRLLLANAPVCKQ
EVS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtttcgctcttcaggactctttgccttgctgctgattgtgcttgagtggacccggcct
ggcttgccctctccgctgcggccaatctgtgatcttcgtgtcctcgaccacttcatcaag
gaggcacgggatgctgaggctactatgagggtgtgtaaagaggactgtagtattggcgtg
cccctcatggttcccttgaccagagtggatattggtgtgtgggagaagaaaaatatggcg
gagcaggctcaagaagttcagacaggcctgtggctgttaaacagggccttcatctcatta
catacatccatcagcaactctgcactgcactcccacatagacgccagcgtcagaaacatt
gccagcatcggacaggttctgcgcagcctcagcatacaggactatgtgcctacagtttct
ggtatagatctccaggagacgtggcaagtatcttctgctccagagctcttccaggtccac
attaatttcctgcgtggaaaagtgcgtctcctgcttgccaatgcacccgtctgcaagcaa
gaagtcagctga

DBGET integrated database retrieval system