KEGG   Astyanax mexicanus (Mexican tetra): 103031956
Entry
103031956         CDS       T05042                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04068  FoxO signaling pathway
amex04110  Cell cycle
amex04115  p53 signaling pathway
amex04218  Cellular senescence
amex04310  Wnt signaling pathway
amex04340  Hedgehog signaling pathway
amex04371  Apelin signaling pathway
amex04510  Focal adhesion
amex04530  Tight junction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103031956 (ccnd1)
   04340 Hedgehog signaling pathway
    103031956 (ccnd1)
   04371 Apelin signaling pathway
    103031956 (ccnd1)
   04068 FoxO signaling pathway
    103031956 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103031956 (ccnd1)
   04115 p53 signaling pathway
    103031956 (ccnd1)
   04218 Cellular senescence
    103031956 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103031956 (ccnd1)
   04530 Tight junction
    103031956 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103031956
NCBI-ProteinID: XP_007254687
Ensembl: ENSAMXG00000009707
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVDAVRRAYHDTNLLNDRVLQTMLRAEETYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKSRLQLLGAACMFLASKMKETVPLT
AEKLCIYTDNSIRPCELLQMELLALNKLKWDLASVTPHDFIEHFLTKLQIHQGTKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKNSDSSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSISTETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcaccagctgctgtgctgcgaggtggacgccgtgcggagagcctaccacgacacg
aacctgctgaacgaccgagttttacagaccatgctgagggctgaagagacctacctcccc
tctccaaactacttcaagtgcgttcagaaggaaatcgtgcctaaaatgaggaaaatcgtc
gccacatggatgctggaggtgtgtgaagagcagaaatgtgaagaggaggtttttcccttg
gctatgaactacctggacagattcttgtctgtggagcccactaagaagagcaggctgcag
ttgcttggagctgcctgcatgttcctggcctccaagatgaaggaaaccgttcctctcaca
gctgagaagctctgcatatacacagacaactctattcgtccatgcgagctcttgcaaatg
gagctgctggcgctgaacaagctgaagtgggatctagcctcagtgacaccacacgacttc
attgaacatttcctcaccaagctgcagatacaccagggcaccaagcagatcctgcgcaag
catgcccagacgttcgtggctctatgtgcaacagacgtcaacttcattgcaagccctccc
tccatgatcgcggcaggcagcgtggctgcagcggtgcaagggctttacttgaagaacagc
gacagctctctctcctcccagaacctcaccaacttcctctcgcaggtcatcagaagtgac
ccggactgtctgcggtcatgccaggagcagatcgagtcactgctggagtccagtctgaga
caggctcagcagcacagcatctccacagaaaccaaacgagtggaggaggacgtggacctc
tcatgcactcccacagacgtcagggacattaacatctga

DBGET integrated database retrieval system