KEGG   Astyanax mexicanus (Mexican tetra): 103032041
Entry
103032041         CDS       T05042                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04137  Mitophagy - animal
amex04210  Apoptosis
amex04218  Cellular senescence
amex04620  Toll-like receptor signaling pathway
amex04621  NOD-like receptor signaling pathway
amex04622  RIG-I-like receptor signaling pathway
amex04623  Cytosolic DNA-sensing pathway
amex04625  C-type lectin receptor signaling pathway
amex04920  Adipocytokine signaling pathway
amex05132  Salmonella infection
amex05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103032041
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103032041
  09143 Cell growth and death
   04210 Apoptosis
    103032041
   04218 Cellular senescence
    103032041
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103032041
   04621 NOD-like receptor signaling pathway
    103032041
   04622 RIG-I-like receptor signaling pathway
    103032041
   04623 Cytosolic DNA-sensing pathway
    103032041
   04625 C-type lectin receptor signaling pathway
    103032041
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103032041
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103032041
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103032041
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103032041
Transcription factors [BR:amex03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103032041
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103032041
NCBI-ProteinID: XP_007230234
Ensembl: ENSAMXG00000021617
LinkDB
Position
21
AA seq 615 aa
MDGIFGWPQPPVPQGNPFIEIIEQPKARGMRFRYKCEGRSAGSIPGEKSNDSTKTHPAIK
VNNYSGPLRVRISLVTKSQPYKPHPHELVGKDCKHGYYEADLPERRVHSFQNLGIQCVKK
KDVTDAVSCRLQTQNNPYNIPEAKVWEEEYDLNAVRLCFQATITLANGELYTLEPVVSQP
IYDNRAPNTAELKICRVNKNSGSCNGGDEIFLLCDKVQKEDIEVRFFRDAWESKGSFSQA
DVHRQVAIVFRTPPYCDTNITEPIQVKMQLRRPSDREVSEPMDFQYLPPDPDEYRLLEKR
KRTQGMLQNLKLGSMQSGPLPERRPFSTARRTCTATKPPPAAASVPPVVNPVAVQSTVKP
RPFFNSPPPGQLFTQPKMESSLTPSTGDTWKFLNSLTVQQSSSTAPPPVSQDFHTVNLSD
LHDFSFNAFSQSAPDQANTASGRDGPGSNVVGTTVAQEIQSNYPAQSSSAFQTEHQMDES
ELPEFPSFSEHQVSGMDNINTDDFQALLGQSVMTTESASGIRNCAASLSTVAAPALDAAA
SIGSNQVGNNTGNNATTWMSFPPAIMSLLQNEQMVDATQAGPPGGVGFDDTDTMDSIDDD
RLMSIFASDANVGFL
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggacggaatatttggctggcctcagcccccagtgccgcaaggcaaccccttcatagag
ataatcgagcagcccaaggccagggggatgcgtttccgttataaatgtgagggaaggtca
gcaggcagtattccaggagagaaaagcaatgactccaccaaaacacatcctgccattaag
gtgaataactacagcggccctttacgagtgaggatctctctggttaccaaaagccaaccc
tacaagccccacccccacgagctggtgggtaaagattgtaaacatggatactacgaggct
gaccttccggagagacgagttcacagtttccagaatctgggtattcagtgcgtgaagaag
aaggatgtgactgacgctgtttcctgccgtctgcagacacagaacaacccttataatatt
cctgaagcgaaagtgtgggaagaggagtacgacctgaatgctgtgcgcctctgtttccag
gcaaccatcaccctagccaacggagagctgtacactctggagcccgtcgtctcccagccc
atctacgacaacagagctccaaacacagctgagctgaagatctgtcgggtaaacaaaaac
tctggaagctgcaatggaggagatgaaatctttctactgtgtgacaaagtgcagaaagag
gacattgaggtgcgttttttccgggacgcatgggagagtaagggctcgttctctcaggct
gacgtccacaggcaggtggccatcgtgttccgcactccgccctactgcgatacaaacata
actgagcctattcaagtaaagatgcagctccgcaggccctcagacagagaggtcagcgag
ccaatggacttccagtacctgccccctgacccagatgagtacaggctgttggagaaacgg
aaacggacacagggaatgctgcagaaccttaaactgggatctatgcaatcaggtcctttg
ccagagagaaggccattcagtactgcaagaagaacatgtacagccactaagcctcctcct
gctgctgcaagtgttccacccgtggttaatccagtggccgtgcagtctacagttaagcct
cggccctttttcaactctcctcctccaggacagttgtttactcagcctaaaatggaatca
tctctgacaccctctactggagacacctggaagttcctcaacagtctaactgtgcagcag
agttcctccactgcccctccaccagtctcccaagacttccacactgtaaatctctccgac
ctccatgacttctccttcaacgctttctcccagtcagctccagaccaagccaacacggct
tccggacgagatggacctggaagcaatgtggttggaactacagtggctcaagaaatccaa
agtaactaccctgctcagagcagttcagcgttccagacagaacaccaaatggacgaaagt
gagctcccagaattcccaagcttttccgaacaccaggtgtcagggatggacaacatcaac
actgacgatttccaagcactgctgggtcagagcgtcatgactacagaatcagcatctgga
atccggaattgcgccgcttctctcagcacagttgctgctccagccttggatgctgcagct
agcattggttcaaatcaagtggggaacaacacagggaacaatgcaacgacatggatgtct
tttccaccagccattatgagcctgctgcagaatgagcagatggtggatgccacccaggct
ggtcctcctggaggcgtaggcttcgatgacaccgatacgatggactccattgacgatgac
cgcctgatgtccatttttgccagcgatgccaatgttggctttctgtga

DBGET integrated database retrieval system