KEGG   Astyanax mexicanus (Mexican tetra): 103032565Help
Entry
103032565         CDS       T05042                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103032565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103032565
NCBI-ProteinID: XP_007249233
Ensembl: ENSAMXG00000003354
UniProt: W5K762
LinkDB All DBs
Position
18
AA seq 685 aa AA seqDB search
MSKQNAIFQDVDLQCRVNNRVHHTEEMDSDQLVVRRGQSFSLLLLLCTDTPPQPPDYQLA
LVLQMGKKGEVVVRASSSRAAHGKWWFSEQTAQTEVLLRIHSPADAPVGLYSVTVLLLSA
EGHIVEQTSPYSFYLLFNPWSAADSVYMPDEELLQEYVLNENGILYQGSWDQITSMPWNF
GQFEKAVVDICFEILDNSPAALKHSEMDIANRADPVYVSRTITAMVNANDDRGVVSGRWD
GEYSDGVPPTRWTGSVPILRRWSEGGAQRVRYGQCWVFSAVACTILRCLGIPTRCVTNYA
SAHDTDGNISVDYLFNEELESVSEGRKDMIWNFHCWVESWMSREDLPKGYDGWQVLDPTP
QERSDGVFCCGPCPVQAVREGEVGMKYDAPFVFSEVNADLVCWIVHPDGERTQASLNSGT
VGKNISTKSVNGDYREDITANYKYPEGSMKEREVYEKAGKHVGNRNGRPRQLQLSIKHAQ
AVHGTDFDVIIEVHNDGGEDTQVQLTITSNAVTYNSLHRGECQRKTAELTVPAQKAHKEV
IRLLYDHYGSCVSEHHLIRVTALLQTSGPNNIILQEVNIPLKMPKLHIKVIGEPVVSRKL
TALISFTNPLPVTLQRGVFTVEGAGLTEEQEIQSPNDIGPGQYTAVKFSFKPSRAGLRKL
LVDFDSDRLRDVKGEATIIVQEKKV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaaaatgctatatttcaggatgtggacctacaatgcagggtcaataaccgt
gtccatcacacagaggagatggactcagatcagttggtagtgcgccgaggacagtccttc
tctttgctgctgctgctgtgcacagacactccaccacagcctccagactatcagctcgcc
cttgttcttcaaatgggtaaaaaaggtgaggtggttgtccgggcctctagttcgagagcg
gctcatggtaaatggtggttcagtgagcagacggctcagactgaggtgttactgaggatc
cacagccctgcagacgctccagtggggctttacagtgtgactgtactcctgctctctgct
gagggccacattgtggagcagacaagcccttactccttctacctgctcttcaacccctgg
tctgcagctgactctgtgtacatgcctgatgaggagcttctgcaggagtacgttctgaat
gagaatggcatcctgtaccagggctcatgggaccagatcacctcaatgccatggaatttt
ggacagtttgaaaaggctgtagtggacatctgctttgagatactggataattcccctgct
gccttaaaacactctgagatggatattgctaacagagcagacccagtctacgtcagcagg
accattactgcaatggttaatgcaaatgatgaccgtggggtggtgtctggacgctgggat
ggggaatacagtgacggggtgcctcccacacggtggactggcagcgttcccatcctgaga
cgttggagtgaggggggtgctcagagagtgcggtatgggcagtgctgggtgttctcagct
gtggcctgcacaattcttcgctgtttgggcattcctacccgatgtgtcacaaactatgcc
tcagcccacgacactgatggcaacatcagtgtggactacctgtttaatgaagagctggag
agtgtgtcagagggcaggaaagacatgatttggaacttccactgctgggtggagtcatgg
atgagcagagaggacctcccaaaaggttatgatgggtggcaagtacttgacccaactcca
caggaaagaagtgatggtgtgttctgttgtggaccctgtccagtccaggcagtgagagaa
ggagaggtggggatgaagtacgatgctccttttgtgttttctgaagtgaacgctgaccta
gtctgctggatcgttcatccagatggggagcggacacaagcatcactgaatagcggcact
gtgggcaaaaacatcagtactaagagtgtgaatggcgattacagagaggacattactgct
aactacaaataccctgaagggtccatgaaagagcgagaggtttatgagaaggctgggaaa
catgtgggcaaccgaaatggaaggccccgtcagttgcagctctctataaagcatgcccag
gctgttcatggcacagactttgatgtgatcatagaggtgcataatgacggtggtgaagac
acacaggtacagcttacgatcacgtctaatgctgttacttacaatagtcttcaccgaggg
gaatgccaaaggaagacagctgagctcaccgtaccagcacagaaagctcacaaggaagtg
ataaggctattatatgaccattatggatcgtgtgtatcagagcatcaccttatcagagtc
actgcactccttcagaccagtggaccaaacaacatcatcctgcaagaggtcaacatccct
ttaaaaatgcccaagcttcatattaaggtgattggagaaccagtggtctcacgcaaactg
acagcgctcatatccttcaccaacccattgcctgtcactctccaaagaggtgtgtttaca
gtggagggtgctggacttacagaagagcaggagatccagtcccctaatgatattggaccc
gggcagtacactgcagtcaagttctccttcaaacccagtcgagctggcctgaggaaactc
ctggtcgactttgactcagatagactaagagatgtgaagggtgaagccactataattgtt
caggagaaaaaggtctaa

DBGET integrated database retrieval system