KEGG   Astyanax mexicanus (Mexican tetra): 103032887Help
Entry
103032887         CDS       T05042                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, liver type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00010  Glycolysis / Gluconeogenesis
amex00030  Pentose phosphate pathway
amex00051  Fructose and mannose metabolism
amex00052  Galactose metabolism
amex01100  Metabolic pathways
amex01200  Carbon metabolism
amex01230  Biosynthesis of amino acids
amex03018  RNA degradation
Module
amex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103032887
   00030 Pentose phosphate pathway
    103032887
   00051 Fructose and mannose metabolism
    103032887
   00052 Galactose metabolism
    103032887
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103032887
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amex01009]
    103032887
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amex03019]
    103032887
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103032887
Protein phosphatases and associated proteins [BR:amex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103032887
Messenger RNA biogenesis [BR:amex03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103032887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103032887
NCBI-ProteinID: XP_007230491
Ensembl: ENSAMXG00000003245
UniProt: W5K6V0
LinkDB All DBs
Position
19
AA seq 780 aa AA seqDB search
MSSQSLEKLRMTGAGKAIAVLTSGGDAQGMNAAVRAVTRMGIYVGAKVYLIYEGYQGLVD
GGDNIKLAHWHSVTNIIQLGGTVIGSARCKAFTTREGRVAAAFNLVKRGITNLCVCGGDG
SLTGANIFRSEWSGLLAELVTKGRITPETAKKHDHLNIVGLVGSIDNDFCGTDMTIGADS
ALHRIMEIVDAITTTAISHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
DVMCARLGESRSVGSRLNIIIVAEGAINKKGDPISSSYIKDLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRVLSSKLGMEAVVALMEATPDTPACVIGLSGNQTVRLPLMEAVEMTKEVQK
AMNEKRFEEAIQLRGRSFENNWNIYKLLAYQKPAQEKSNFSVAILNVGAPAAGMNAAVRS
AVRMGLAAGHRVYTVSDGFEGLANGEVNEVSWHSVAGWTGQGGSLLGTKRTLPSTCMEKL
VENLNKYNIQSLLVVGGFEAYEGILELFDARGHYDELCIPMCIIPATISNNVPGTDFSLG
ADTAVNAAMESCDKIKQSATGTKRRVFVVETMGGYCGYLATTTGIAVGADAAYIYEDAFD
IHELKTNVEHLTEKMKKDIQRGLVLRNEKSHKHYTTDFIYNLYSAEGKGVFDCRVNVLGH
LQQGGAPSPFDRNFGTKLGVRAVQWLTEKMTDTYRQGRVFANSPDTVCVVGLNKKALTYC
PVTEVKKQTDFEHRMPKEQWWLGLRLLLKMLAKYQTSFDQYITGEIEHVTRRSLSIDPGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcagtctctggagaagctgcggatgaccggggctgggaaagccatcgccgtg
ctgaccagtggaggagatgcccagggtatgaacgctgctgtccgtgctgtcactcggatg
ggtatatacgtcggagccaaggtgtatctgatttatgagggttaccagggcttggtggat
ggaggagacaatattaaactggctcactggcacagtgtgaccaacatcattcagctggga
gggacagtaataggcagtgcacgctgcaaagccttcaccacacgggagggacgggtggcc
gctgcctttaacctggtgaaacgggggatcaccaatctgtgcgtgtgtggaggggacggc
agcctcactggggccaatatcttcaggagcgaatggagtggactgctcgctgagctggtg
acaaaaggcaggatcactcctgaaactgcaaagaagcatgatcacctgaacattgtgggc
ctggtcggctccatcgataatgatttctgtgggactgacatgaccattggtgcagattct
gctctccatcgtattatggagatcgttgatgccattaccaccactgccatcagccaccag
cgcacgtttgttctggaggtgatgggccgacactgcggatatctggctctggtgtctgcg
ctggcgtctggagcagactggctctttattcccgaggctcccccggaggacggctgggag
gatgtcatgtgtgctcggctgggagagagccgcagtgttggatccaggctcaacattatt
atagtcgctgagggagcaatcaataaaaaaggcgacccaatctcctccagctacatcaaa
gatcttgtggtgaagcggttgggatacgacaccagggtaactgtactgggccacgtacag
agaggaggaactccctcagccttcgatcgagtgctaagcagtaaactgggaatggaggca
gtggtggcattgatggaggcgactccagacacccccgcctgcgtgatcggtctctcgggc
aaccagacagtgcgtctccctcttatggaagcagtggaaatgactaaggaggtacagaag
gccatgaatgagaaaaggtttgaggaggccattcagctgcgtggaaggagctttgaaaac
aactggaacatttacaagttactggcttatcagaaacctgctcaagaaaagagcaatttc
tcagtggccattctgaacgttggagcacctgcagcaggtatgaatgcagcagtgaggtct
gcagtgaggatggggctggctgcgggacacagagtctacactgttagcgatggatttgag
ggcctcgccaatggagaggtcaatgaggtgtcttggcatagtgtggctggttggactggc
caagggggctcacttctagggactaaacgaactcttcccagtacctgcatggaaaagttg
gtggaaaacctgaacaagtacaatatccagtcactgctagtggttggaggatttgaggct
tatgaagggattctggagttgtttgatgccaggggacactatgatgagctgtgtattccc
atgtgcatcattcctgccaccatcagcaacaacgttcctggaactgatttcagcttggga
gctgatactgctgttaacgcagctatggagagctgtgataagatcaagcagtctgcaaca
ggaacaaagaggagggtctttgtggtggagaccatgggcggatattgtggatacctggca
accaccactggcattgcagttggggccgatgcggcatatatctatgaggatgctttcgat
atccatgaattaaagacaaatgtcgagcatctgacagagaagatgaagaaggacatccag
aggggtctggtgctgaggaatgagaaaagccataaacactacaccactgattttatctac
aacttgtactctgctgaggggaaaggtgtgtttgactgcagagtgaatgtcctgggacat
ctccaacagggaggtgcaccctcaccttttgacagaaattttggcaccaagcttggagta
agggcagtgcagtggcttacagagaagatgactgatacatacagacaaggtcgcgtgttt
gccaactccccagacacggtttgtgtggttggcttaaataagaaagcgctcacttattgc
cctgtgaccgaggtgaagaagcagactgactttgagcacagaatgcccaaagaacagtgg
tggctgggactacgattgctgctcaagatgctggccaaataccaaacatccttcgaccag
tatatcaccggagagattgaacatgtgacccgtcgctctctcagtatagaccctgggttt
tag

DBGET integrated database retrieval system