KEGG   Astyanax mexicanus (Mexican tetra): 103033109
Entry
103033109         CDS       T05042                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
amex  Astyanax mexicanus (Mexican tetra)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2
Other DBs
NCBI-GeneID: 103033109
NCBI-ProteinID: XP_007234513
Ensembl: ENSAMXG00000013775
LinkDB
Position
22
AA seq 356 aa
MAKWELIELKDLTPNDGIELAPPSGSTAVLPASKQKAPEPFAVRLVGDAVSLENARWVNG
KHGEGHHFQPCSYTQLTWCDLCGEFIWGLYQQSLSCSHCRYTCHFRCHPFIQLDCSSHSE
AAAEQPDYSEDIETDTNVDDPVDWRKQELSVSEIQQKVKEYNAQINSNLYMVLNRDGSYT
GFIKVLFKLSRPVSLPPPRSPSPPASGPEGAVLTRRTSFYLPRDAAKHLHVSSHTQVREV
ITALLNKFTVVDNPAKFALFERSERHGQVYLKKLGDEECPLQLRLCAGPSEKSLSFVLKE
NETGEVNWEAFSLPELKNFMRILQKEEEDHVRQIIRRYSLAREKMREALKHFSTPG
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggccaagtgggagctgattgaactgaaagatttaacccctaatgatgggattgagcta
gcgccccccagtggatccactgcagtactgccggcgtccaagcagaaagctccagagccc
ttcgccgtgagattggtgggcgatgctgtgagtttggagaatgcccgctgggtcaatggc
aaacatggagaaggccaccacttccagccctgcagctacacccagctgacctggtgtgac
ctgtgtggagaatttatctgggggctgtaccagcagagcctaagctgcagccactgcagg
tacacctgtcatttccgctgtcatcccttcatccagctggactgcagttcacacagtgaa
gcagctgctgaacagccagactacagcgaggacatcgagacagacactaatgtggatgat
ccagtcgactggagaaagcaggaactgtccgtcagcgaaatccagcagaaagttaaagaa
tacaatgctcagatcaacagtaacctctatatggttctgaatcgggatgggtcgtacact
ggtttcattaaggtcctgtttaagctgtcccgccctgtgtccctgccaccccctcggagt
ccctccccccctgcctcagggccagagggggcggtgcttacccgcaggacgtccttctac
ctccccagagacgctgctaaacacctgcacgtcagctctcacacacaggtcagagaggtc
atcaccgccctgctcaacaaattcactgtggtggacaacccggccaaattcgccctgttc
gagcgcagcgagcgccacggacaagtgtatctaaagaagctgggcgatgaagagtgtccg
ctgcagctgcgtctgtgtgcaggtcccagtgagaaatccctgagctttgtgttgaaagag
aacgagactggagaggtcaattgggaagcgttcagtctgcccgagctgaagaacttcatg
cggatcctgcagaaagaggaggaggatcatgtgagacagatcatccggcgctactcactg
gcccgagagaagatgagagaagctctgaaacatttcagcacacctggatga

DBGET integrated database retrieval system