KEGG   Astyanax mexicanus (Mexican tetra): 103033125Help
Entry
103033125         CDS       T05042                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amex01002]
    103033125 (tmprss9)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103033125 (tmprss9)
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103033125 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Ldl_recept_a DUF1986 SEA DUF1922
Motif
Other DBs
NCBI-GeneID: 103033125
NCBI-ProteinID: XP_015457736
Ensembl: ENSAMXG00000015716
LinkDB All DBs
Position
5
AA seq 779 aa AA seqDB search
MKKHLDKSPQSDPALAQSSFAYRCFIVAIILLLLIIGVFVGVFIAYLVQEEHYFMETVEL
KGLKYNTDLQDKTSAFSLILTATLETKIQNVFVASSIAQHFLACQIIAYGNINGDVMATF
HLVFRVAKFQKYTDSFIQEHLRYGLVSLLRQKPLSIPEFGEISSIVLLGATGKSFYSIEA
DRSICPANTYTCASGECVTKPNPECDFISDCADQSDEAYCSCGLRPAMGSRVVGGQNARH
GEFPWQVSLKLRGRHTCGASIISSRWIVSAAHCFESNKNPKDWRALVGSSLVSGAENGAT
TINIKSLIVSPDYNPMTTDSDVTVLELEKPLTFSAYIQPVCIPSFSHTFIPGQNCIVSGW
GALSQDSREVPPTLQKAVVKVIDSDVCNSSVVYRGAITNNMMCAGFLQGRVDSCQGDSGG
PLVCEGAPGRFFLAGIVSWGVGCAQVNKPGVYSRVTKLRNWIMSHTEQSGIHGGSMVRST
MKSGGHLTKPITPPSVLPAVNCGGNFSCGTGECISKINPECDQITDCSNAADEKNCDCGR
RPAVGRQRIVGGVTARRGEWPWVASLQFQRSHRCGATLIHCKWILTAAHCFREPNPSGWT
VSLGSVLRSGVSALVIPVQRFIIHPNFTSSTMDFDVALVELSIPAPSSYTIQTLCLPSPS
HSFFNSSECYIMGWGAIREDGKLTTLLQKAKVSIIDQSDCLPSYSGRLTANMVCAGSMEG
GKDTCLGDSGGPLACRQPHGRWFLAGVTSWGHGCGRSSFPGVYMRVTAVREWISKYLPF
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacacctggacaaatcacctcagtctgatcctgcgctggctcagtcttcattt
gcatacagatgctttatagtggccatcatcttattgctgctcattattggtgttttcgtt
ggcgtcttcattgcatacttggtgcaggaggagcattacttcatggagacagtggagtta
aaagggctcaaatataatactgacctccaagataaaacctcagcgttctccttaatactt
acagctaccttggaaacaaagatccaaaatgtctttgtggcttcatcaatagcacaacat
ttccttgcctgccagataattgcatatggaaacattaatggagatgtgatggcaacattt
catttagtcttcagagtggccaaattccagaaatacacagacagcttcatccaggagcat
ctccgctatggacttgtgtctttgcttcgccaaaaacctctgagcattccagagtttggg
gagatcagcagcattgttctgctgggagccactggaaagtctttctactcaattgaagct
gacagaagtatatgtcctgccaacacttacacctgtgccagcggggagtgtgtcactaaa
cccaatccagagtgtgacttcatatctgactgcgctgatcagtctgatgaggcgtactgc
tcatgtgggctgcggccagcgatgggcagccgggtagttgggggtcaaaacgcccgtcat
ggtgagttcccctggcaagtgagtttaaaactgcgcggccggcacacctgtggagcctct
attatcagcagccgctggattgtgagtgctgctcactgtttcgagagcaataaaaacccg
aaggactggagggccctggtagggtccagcctggtgagtggagcagagaatggagccact
acaataaacatcaagtctctgattgtgtctccggattataaccccatgacgacagacagc
gatgtgacagtgctggagctggagaagcctctgaccttcagtgcctatatccagcctgtc
tgcatcccatctttttcacacaccttcattcctggacaaaactgcattgtctccggctgg
ggggccctcagtcaggacagcagagaggtgcctcccacactccagaaagctgtggtgaag
gtcatcgactctgacgtctgcaactcatcagttgtgtacagaggagccattactaataat
atgatgtgtgctggctttctgcagggtcgagtcgactcctgtcagggagactcaggtggt
cctctggtttgtgaaggggctcctgggcgcttctttttggctggtattgtgagctggggg
gtgggctgtgcccaagtcaacaaacccggagtgtattcacgtgtcaccaaacttcgcaac
tggatcatgagccacacagagcagagtgggattcatggtggctccatggttcggagcact
atgaagtctgggggtcacctgactaagccaatcacaccaccgtctgtcctgcctgctgtg
aactgtggtggaaacttcagctgtggaacaggagagtgcatcagcaagataaatccagag
tgtgaccaaattactgactgctctaatgcggccgacgaaaagaactgtgactgcgggcgg
cgtccagcagtgggccgacagaggatagtgggaggtgtaactgcccgaagaggggaatgg
ccttgggtggctagcctacagtttcagcgctcacatcgctgtggagccacattaattcac
tgcaaatggattctgacagcagcacactgcttcagggagccgaaccccagcggctggacg
gtgagtttgggctcagtgcttaggtctggagtcagtgctctggtcattccagtccaaagg
ttcatcatacaccccaacttcaccagcagcaccatggactttgatgtagctctggttgag
ctttctatccctgcaccgagttcatacaccatccagacgttgtgcttaccctcccccagc
cacagcttcttcaacagctctgagtgctacatcatgggatggggtgcaataagggaggac
ggtaagctaaccactctgctgcagaaagctaaggtcagtataattgaccagtcagattgt
ctgccatcttacagcgggagactgaccgccaacatggtgtgtgccggctccatggagggt
gggaaggacacctgtctgggagactccgggggtcctctggcatgtcggcagccccacggc
cgctggtttttagctggagtgaccagctggggtcacggctgcgggcggagcagctttcca
ggggtttacatgcgcgtcactgctgtcagggaatggatatcaaaatacctccctttttaa

DBGET integrated database retrieval system