KEGG   Astyanax mexicanus (Mexican tetra): 103033344
Entry
103033344         CDS       T05042                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04068  FoxO signaling pathway
amex04217  Necroptosis
amex04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103033344 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103033344 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103033344 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103033344 (stat3)
Transcription factors [BR:amex03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103033344 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Talin_middle Halogen_Hydrol BLOC1_2
Other DBs
NCBI-GeneID: 103033344
NCBI-ProteinID: XP_022528246
Ensembl: ENSAMXG00000000502
LinkDB
Position
2
AA seq 788 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAQQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
AGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTELAALLQAMDFVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPIV
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPSVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKI
MDATNILVSPLVYLFPEIPKEDAFGKYCRPEAQPDVDFQEPGCAIQPYLKTKFICVTPCP
SVFMDFPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHTEVQEANPGPLESLTLDMEL
NSDVASPM
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcagcagctggagacgcgctacctggaacagctgtaccat
ttgtacagtgacagcttccccatggagctgcgccagtttctagctccctggatcgaaagt
caagactgggcatatgcagccaataaggagtcccacgccaccctggtgtttcacaacctg
ctgggagagatcgaccagcagtacagccgcttcctgcaggagaacaacgttctgtaccag
cacaacctgagacggatcaaacagcacctgcagagcaagtacctggagaagcccatggag
atcgcccgcattgtagcccgctgtctgtgggaggagcagagactactgcagacggccacc
accgctcagcaagacggtcaagctgcccatcccacaggcactgtcgtaacagagaaacag
caaatcctggagcacaacctgcaggacatcaggaagagagtgcaggatatggaacagaag
atgaagatgttagagaacttacaggatgactttgacttcaactacaagactctgaagagt
gctggagagctatctcaggacctgaatgggaacagccaggctgcagctactagacaaaag
atggctcagctggagcagatgctgagtgccctggatcaactcaggaggcaaatcgtgact
gagttggctgcgctgctgcaggccatggattttgtgcagaagaatctgacggatgaagag
ctggctgactggaagagaagacagcagatcgcctgcattggaggaccgccaaacatctgc
ctggaccggctagagacatggatcacctcattggccgagtctcaactgcagatcaggcag
caaataaagaagctagaagagcttcagcagaaagtctcgtataaaggggaccccatcgtt
cagcaccgccctgccctggaggagaagatcgtagacttgttccgcaacctcatgaagagt
gcgtttgtggtggagaggcagccgtgcatgcccatgcatccagacagacctctggtcatc
aagacaggagtccagttcaccaacaaagtgaggctactggtgaaatttccagagctgaat
tatcagctgaaaatcaaagtgtgcattgacaaggaatccggggatgtggcagccattcga
gggtcacgcaagttcaacatcctgggcactaacactaaggtgatgaacatggaggagtcc
aataatggcagcctgtcagctgaattcaaacacctgactcttcgagaacagaggtgtggc
aatggaggacggaccaacagtgatgcctcgcttattgtgactgaggagcttcatcttatc
acctttgagacggaggtttaccaccagggcctcaagattgaccttgagacacactcgctc
cctgttgtagtcatttccaacatctgtcagatgccaaacgcatgggcctccattttgtgg
tacaacatgctgaccaaccaccccaagaacgtaaatttcttcaccaagcctcctgtgggc
acgtgggatcaagtggctgaagtgctgagctggcagttctcctccacaaccaagagaggc
ctgaccattgagcaactcaccacacttgcagagaaactgcttggtccttccgtcaactac
tccggttgccagatcacctgggctaagttttgcaaagagaacatggcagggaaaggtttt
tcgttctgggtgtggttggataatatcattgatctggtgaagaagtatattctggctctg
tggaacgagggctatattatgggattcatcagtaaggagagagaaagggcaatcctgagc
ccaaagcctcctgggacgtttctgctacgcttcagtgagagcagtaaggagggaggcatc
acgttcacctgggtggagaaagacatcagtggtaagacacagatccagtcggtggagccc
tacactaagcagcagttgaacagcatgtccttcgccgagatcatcatgggctataagatc
atggacgccaccaacatcctggtctctccgctggtctaccttttccccgagatccccaaa
gaggacgccttcggcaagtactgccggcccgaggcccagcccgacgtagacttccaagag
cctggatgtgccattcagccatatctgaagaccaagtttatctgcgtcaccccgtgtcct
tctgtcttcatggacttcccggacagtgaactgctggggaacggcttccctgggactaac
tcaggcaacacgagtgacctgttccccatgtctcctcgcactctcgactcactgatgcac
accgaagttcaggaggccaacccgggacctctcgaatccctcactctggatatggaattg
aactcagatgtggcttcacccatgtga

DBGET integrated database retrieval system