KEGG   Astyanax mexicanus (Mexican tetra): 103033787Help
Entry
103033787         CDS       T05042                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00052  Galactose metabolism
amex00500  Starch and sucrose metabolism
amex01100  Metabolic pathways
amex04142  Lysosome
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103033787
   00500 Starch and sucrose metabolism
    103033787
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103033787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amex04147]
    103033787
Enzymes [BR:amex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103033787
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103033787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103033787
NCBI-ProteinID: XP_022530638
Ensembl: ENSAMXG00000013975
LinkDB All DBs
Position
12
AA seq 959 aa AA seqDB search
MVSYKRLNPEEVNFSGATEDSGDAEAKTEDLERPLLEQRSQCSSTVALLTLGGLILVVLG
VWLLGTVFWLRGPPSTEIHKPPPPVASPGQSREWDGGAQPESCTLIPEGWRFDCYPERGV
VVNEEMCHKRNCCFIQVAEEKSPGQNGVPWCFYPPDFPSYELVTNNETEMGYRGKLVRRQ
KTYYPNDIETLQLDVLYESDSRLRIRVTDPAKDRYEVPIDVPVVKKKASNPLYTVEFTEQ
PFGLIVKRKQNGAVLLNTTVAPLFYADQFLQMSTSLASEFVYGLGEHRSNFLHDVQWNTL
TMWTRDAAPVELTNLYGVHPFYLLMESDGLAHGSFLLNSNAMDVVLQPAPALTWRTIGGI
LDLYVFVGPDPSSVVGEYLEVVGKPAMPIYWALGYHLCRWGYDSSNNTWDVVKKMRNNQI
PQDVQWNDIDYMDRALDFTHDPVNFATLPDLVKDLHIHDQHYVMILDPGISSTQPAGSYL
PFQEGIKQGVFITNSSGDLLIGKVWPGLTAFPDFSNPDTHEWWYQNLKTFHDQVPFDGLW
IDMNEPSNFLDGSVDGCPSNDLENPPYTPAVLGGSLRAKTVCASARQKLNSHYNLHNLYG
LMEAKASASALKKLLKKRPFVISRSTFSSHGVYSGHWLGDNRSQWKDLYMSIPGMLTFNI
LGIPLVGADICGFSATTTEELCVRWTQLGAFYPFTRNHNTKDSQAQDPTVFSPAARKAMT
EVLLLRYSLFPFLYTLFHHAHLSGHTVARPLFFEFPRDLKTYKIDKQFLWGKSLLVTPVL
APGVDYVVGYLPQGIWYDFYTGDSLVSKGEEIKLHAPLDKINLHLREGSITPTQRPNTTL
WVSSSQPLHLIACLTEDGLAEGDLFWDDGETIDTYETDQYAYFIFRLKQNTMTSEVVHSH
MEATYITVETVSFYGLKKGPTSVTVNSQEASFIYTTNQVLKVYDLGLNLSQNFTISWVS
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcctacaagaggctgaacccagaagaggtgaacttttctggggccactgaagat
tcaggcgatgctgaggcaaagacagaagacctagagcgtcctctgctggagcagagatct
cagtgctcctccactgttgctctgttgaccttgggagggcttattctggtggtccttggg
gtttggctgctggggactgtcttttggttgcgtggtccaccttcgactgaaatccataaa
cctccaccgcctgtagcctctccaggccaaagcagggagtgggatggtggggctcagcca
gaatcctgcaccctcatcccagaaggctggaggtttgactgctatccagagagaggtgtt
gtggttaatgaggagatgtgccacaagaggaactgttgcttcatacaggtagcagaagaa
aagtcacctggacaaaatggagtgccatggtgcttctatccacctgactttccatcttat
gagttggtgaccaataatgagactgagatgggttacagggggaagctggttcgtcggcag
aagacctactatcctaacgatatcgagacgctacagttggatgtactgtatgagtctgac
agcaggctacgcatcagagtaacagatccagcaaaggatagatatgaagttcccatagat
gtgcctgttgtgaagaaaaaggcttcaaatcctttgtacactgtggagtttaccgaacaa
ccctttgggcttattgtcaaaagaaaacaaaacggggctgtgctgctaaacacaacagtg
gctccactcttctatgcggatcaatttctgcaaatgtccacatccttggcatcagagttt
gtttatggactgggggagcatcgctccaactttctgcatgacgtgcagtggaacacgcta
accatgtggactcgggatgcagcaccagtggagctcaccaacctttatggagtccatccg
ttttaccttctgatggagtctgatggactggcacacgggtctttcttactcaacagcaat
gcaatggatgttgttcttcagccagctcctgccctcacatggcgcacaatcgggggaatt
ctggatctgtatgtctttgttggccctgatcccagttctgtggttggagagtatctggag
gttgtaggaaagcctgctatgcctatatactgggcattgggatatcacctttgccggtgg
ggctacgactccagcaataacacctgggatgttgtaaagaaaatgagaaacaatcagatc
cctcaggatgtgcagtggaatgacatcgactacatggaccgtgccttggacttcactcat
gaccctgttaattttgcaaccctgcctgaccttgtgaaagaccttcatatacacgatcag
cattatgttatgatactggatccaggcatcagcagcactcagccagcaggatcctatttg
cctttccaggaaggaataaaacagggtgtttttatcaccaactccagtggagacctgctc
attggcaaggtctggccaggcctcacagcgttcccagacttctccaacccagacacacat
gagtggtggtaccaaaacctgaagacgttccatgatcaagttccttttgacgggctgtgg
atcgacatgaatgaaccatctaatttcctcgacgggtctgttgatggctgcccaagcaat
gacttagaaaaccctccttatacaccagctgttctaggtggcagtttgagggctaagaca
gtttgtgcatctgcacgccagaagctcaactctcactacaacctgcacaacttgtatgga
ctcatggaagccaaggcttcagcaagtgctttgaagaagctcctgaaaaaacgaccgttt
gtgatttcccgctcaacgttttccagtcatggagtctactccggtcactggctaggagac
aacaggagccaatggaaagatttatacatgtctattccaggcatgctgacttttaatatt
ttgggcattccgctggtgggagcagacatctgtggcttttctgccaccaccactgaagag
ctgtgtgtgcgctggactcagctaggagcattctaccccttcaccagaaaccataacact
aaagactctcaggctcaggatcccaccgtctttagtcctgctgctcgaaaagcgatgaca
gaagtgcttctcctccgttattccctctttcctttcctctacacactctttcaccatgct
cacctcagtggacacactgtggccagacccctgtttttcgagttcccaagagatctaaag
acatacaagatagataaacagtttctttggggaaagagtttgctggtgactccagttttg
gcccctggggtggattatgtagtcggctatctgccccagggcatctggtatgacttttat
acgggtgactccttggtcagcaagggggaagaaattaagctccatgctccactggacaaa
attaacttgcatctcagggagggatccatcacacctacacagagacctaacacgactctg
tgggtgagcagcagtcagcccctgcacttaatagcgtgtctgactgaggatggcctggca
gagggagaccttttctgggacgacggggagactatcgacacttatgagactgaccagtat
gcctactttattttcagactgaaacagaacactatgacctcggaggtggtgcacagtcac
atggaggctacatacatcacagtcgagacagtttctttctatgggttgaagaaagggccc
acctccgttactgtcaactcccaggaagcttctttcatctacacaaccaatcaggtgttg
aaagtatatgacttgggtctgaaccttagtcagaactttacaatcagctgggtatcataa

DBGET integrated database retrieval system