KEGG   Astyanax mexicanus (Mexican tetra): 103033930Help
Entry
103033930         CDS       T05042                                 

Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00512  Mucin type O-glycan biosynthesis
amex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103033930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:amex01003]
    103033930
Enzymes [BR:amex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103033930
Glycosyltransferases [BR:amex01003]
 O-Glycan biosynthesis
  Mucin-type
   103033930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 103033930
NCBI-ProteinID: XP_007248710
Ensembl: ENSAMXG00000004115
UniProt: W5K9E8
LinkDB All DBs
Position
1
AA seq 617 aa AA seqDB search
MIRLIGFRTLKSLMAFVMRRWKILLVLNAFAVAGFLTFWGKCNIRTSRGSGQQVPTDTRG
QTRLNGSALDSGIIQEVLLKRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGRGGLPATLNP
MEEKEAKYLREKYGYNAFLSDRISLDRSIPDYRPSKCKKAYYPRDLPQISLIFIFVNEAL
SVILRSVHSAVNHTPAHLLKEIILVDDNSDDEQLKGPLEEYVNKRYPGLVKIVRNQKREG
LIRARIEGWKVATGEVTGFFDAHVEFTPAWAEPVLSRIKENPKRIILPSIDNIKDDTFEL
ERYENSGHGFNWELWCMYISPPKQWWDEGDTSAPIRTPAMIGCSFVANREYFGELGLLDS
GMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARTKKPYHSNIAFHTRRNALRVAEVW
MDEYKSNVYLAWNIPMENHGIDYGDVSERVALRNNLQCRNFEWYLDNIYPEMRRYNSTLF
YGEIRNINVTRLCVDQGVKENHTATLHPCHGWGPQLGRYTKEGFLFLGPLGSTGEDTRCV
VDDRVSSFPQLVNCEKMSNVLQKTWNFAQNESIVNRATGRCLEVVQANVYFGYALVLRSC
TGQRWNIRNTMRQRQGQ
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgatacgactcattgggttcaggacgctaaagtcattgatggcttttgtgatgaggaga
tggaaaatcctgcttgtgctcaacgccttcgccgtggccggtttcctgaccttctggggc
aagtgtaatatccggacaagccgaggcagcggtcagcaggtgcccactgacaccaggggg
cagacgcgcttgaacgggtctgctttggacagtggcatcattcaggaggtcctgctgaag
agacttggctcgctagaagatgtagtctacagacaacttaatggtttgtccaagtctctt
ggtctcattgagggctttggaggccggggcagaggaggcttgcctgccaccctgaatcct
atggaggagaaggaagccaagtatctgcgggagaagtatggctacaatgcgttcctgagt
gacaggatatctctggataggtccatcccagactaccgccccagcaagtgcaagaaggcc
tattatcccagagacctgccacagatctccctcatcttcatcttcgtcaatgaggcgctg
tcggtcatcttgcgctccgtccactcggccgtcaatcacactcccgcccacctactcaaa
gagatcatcctggtggacgacaacagcgatgacgagcaactgaaagggcctctggaagag
tacgtcaacaaacgctacccaggcctcgtgaaaatcgtgcgcaatcagaagagggagggt
ctgatccgtgctcgtatcgagggctggaaggtggctacaggagaagtgacgggatttttt
gacgcccatgtggagttcactcctgcctgggctgaaccagttttgtccaggatcaaggag
aaccccaagaggatcatcctgccctccatagataacattaaagacgacacttttgagctg
gagcgctacgaaaactctggtcatggattcaactgggagctctggtgcatgtacatcagt
cctcccaaacagtggtgggatgaaggagacacttctgcacccatcaggacacctgcgatg
ataggctgctcgttcgtggccaaccgggaatacttcggagagctgggcttgctggactca
gggatggatgtctatggaggagagaatatagagctcggaatcagggtttggctgtgtgga
ggcagtatggaggtcctgccttgctccagggtggcccacattgccaggacgaaaaagccg
taccacagtaacatcgccttccacaccaggcgcaatgcactgcgcgtagcggaggtgtgg
atggacgagtacaagtcaaatgtctacctggcctggaacattcctatggagaaccacggc
attgattatggtgatgtatcagagcgtgtggcgctaagaaacaacctccagtgcaggaac
ttcgagtggtacctcgacaacatctaccctgagatgaggagatataacagcactctgttt
tacggggagattcgcaacatcaacgtgacccgtctgtgtgtggaccagggcgtgaaggag
aaccacacggcgaccctccacccctgccatggctggggccctcagctgggtcgctacact
aaggagggcttcctgtttctggggccgctgggcagcaccggggaggacacgcgatgcgtg
gttgatgatcgggtcagcagcttccctcagctcgtcaactgcgagaaaatgtccaatgta
ctgcagaaaacatggaactttgcacagaatgaatcaatcgtgaaccgagctacaggacgc
tgtctggaggtggtgcaggcgaacgtctacttcggctacgctctggttctgcgatcgtgc
acgggccagaggtggaacatcaggaacacgatgaggcagcgacagggacagtga

DBGET integrated database retrieval system