KEGG   Astyanax mexicanus (Mexican tetra): 103034062Help
Entry
103034062         CDS       T05042                                 

Gene name
aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00010  Glycolysis / Gluconeogenesis
amex00053  Ascorbate and aldarate metabolism
amex00071  Fatty acid degradation
amex00260  Glycine, serine and threonine metabolism
amex00280  Valine, leucine and isoleucine degradation
amex00310  Lysine degradation
amex00330  Arginine and proline metabolism
amex00340  Histidine metabolism
amex00380  Tryptophan metabolism
amex00410  beta-Alanine metabolism
amex00561  Glycerolipid metabolism
amex00620  Pyruvate metabolism
amex01100  Metabolic pathways
Module
amex_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
amex_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103034062 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    103034062 (aldh7a1)
   00620 Pyruvate metabolism
    103034062 (aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103034062 (aldh7a1)
   00561 Glycerolipid metabolism
    103034062 (aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103034062 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    103034062 (aldh7a1)
   00310 Lysine degradation
    103034062 (aldh7a1)
   00330 Arginine and proline metabolism
    103034062 (aldh7a1)
   00340 Histidine metabolism
    103034062 (aldh7a1)
   00380 Tryptophan metabolism
    103034062 (aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103034062 (aldh7a1)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103034062 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     103034062 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     103034062 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 103034062
NCBI-ProteinID: XP_007252494
Ensembl: ENSAMXG00000012847
UniProt: W5L055
LinkDB All DBs
Position
20
AA seq 540 aa AA seqDB search
MQRVLLLTALRHSALTAKVCSVRFQPSAAMSTLLINQPKYAWLKELGLSEDNDGVYNGTW
GGKGEVVTSYCPANNEPIARVRQATLAEYEETVQKAREAWKVWADIPAPKRGEIVRQIGD
ALRKKIKVLGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALI
EQWNPVGLVGIITAFNFPVAVYGWNNAIALICGNVCLWKGAPTTPLTSVAVTKIVAEVLE
QNNLPGAICSMTCGGADIGTALSKDERVDLVSFTGSTQVGKQVALMVQERFGRQLLELGG
NNAIIVFEDADLNLVVPSALFASVGTAGQRCTTTRRLMLHESVHDEVVERLSKAYKQVRI
GDPWDPSTLYGPLHTKHAVQQYLAAIEQAKQQGGTLVCGGKVMDRPGNYVEPTIFTGLAH
DAPIVHTETFVPILYVIKFKTEEEAFAWNNEVKQGLSSSIFTKDMGRVFRWLGPKGSDCG
IVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIKFE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgttctgctcctcaccgcgctacggcactctgccctcactgctaaagtctgc
tctgtccgcttccagccgtctgcagccatgtctacactcctcatcaaccagcccaaatac
gcctggcttaaagagctgggtctgagcgaggacaacgacggggtttacaacggcacctgg
ggaggcaagggcgaggttgtcacatcttactgtcctgctaataatgagcccattgccaga
gtgcgacaggccaccttggcggaatatgaggagacggtacagaaagccagagaagcatgg
aaagtgtgggcagatatccctgctcccaaaagaggtgaaattgtgagacagatcggtgat
gctctacgaaagaagatcaaagttcttggcagcttggtgtctctggagatggggaagatc
tatgtggagggggttggcgaagtgcaggagtatgttgatgtgtgtgactatgctgtcggg
ctctctcgtatgattggcggccctgttctgccctctgaaagaccaggtcatgcccttatt
gagcagtggaaccctgtgggtttggtgggcattataactgcctttaacttccctgtggca
gtgtatggctggaataatgctattgccctcatctgtggcaatgtgtgcctttggaaagga
gctccaaccacacctctcaccagtgtagccgttacaaagattgtagctgaggtgctggaa
cagaataacttgccaggtgctatctgctctatgacatgcggtggagctgacattggcaca
gcattatctaaagatgaacgggtcgacctggtgtcctttactggcagcactcaagtgggc
aaacaggtggctctgatggtgcaggagaggtttggtcgccagttgctagagctgggtgga
aacaacgccatcattgtttttgaagatgctgatctgaacctggtggtgccttcggctctc
tttgcctctgtgggaactgcaggccagcgctgcaccacaaccaggagactgatgctgcac
gagagtgttcatgatgaggttgtagaaaggttatccaaagcttacaagcaagttcgaatt
ggtgacccctgggatcctagtacactgtatggaccacttcacaccaagcacgctgttcag
cagtacctggctgccatagagcaggcgaagcagcagggcggcactcttgtgtgtggtgga
aaggtaatggatcggcctggtaactatgtggagcctaccatcttcactggactggcacat
gatgcccctattgttcacacagagacctttgtgcccattctctatgtgatcaagttcaag
acagaggaggaggcctttgcctggaataatgaagtcaagcaaggcctttccagcagcatc
ttcacaaaggacatgggccgagtgttccgctggctaggacccaaaggctcagactgtggc
atcgtcaacgtcaacattccaaccagcggagctgagattggtggagcttttggaggggag
aagcacaccggaggtggacgtgagtcaggcagcgactcatggaagcagtatatgaggagg
tccacatgcaccatcaactacagcaaggacctcccactggcacaaggaatcaagtttgag
tag

DBGET integrated database retrieval system