KEGG   Astyanax mexicanus (Mexican tetra): 103034574Help
Entry
103034574         CDS       T05042                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00590  Arachidonic acid metabolism
amex01100  Metabolic pathways
amex04370  VEGF signaling pathway
amex04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103034574
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103034574
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103034574
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103034574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF DctM
Motif
Other DBs
NCBI-GeneID: 103034574
NCBI-ProteinID: XP_007245479
Ensembl: ENSAMXG00000010238
UniProt: W5KSF5
LinkDB All DBs
Position
3
AA seq 608 aa AA seqDB search
MHRTASLLLCLYLGCLACEGANPCCSQPCQNRGVCTELGTDAYECDCTRTGYYGQNCTTP
ELLTWIKVSLKPLPNTVHYILTHFKGLWNIINNISFMRDAIMRYVLTSRSHLIDSPPTFN
SDYGYKSWEAYSNLSYFTRTLPPVPQDCPTPMGVAGKKELPDVKIVAEKLLLRRKFIPDP
QRTSLMFAFFAQHFSHQFFKTDMKKGPAFTRAKGHGVDLSHIYGEELERQHKLRLFKDGK
LKFQILDGEVYPPTVSDVQVDMHYPPHVPESHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDILKQEHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFKERF
QYQNRISSEFNTLYHWHPLMPDDFHIQDEVFSFKQFIFNTSILTNYGVNNLVESFTKQIA
GRVAGGRNVAPAVLMVAMKSIENSRQMRYQSLNAYRKRFNLKPYVSFEDMTGEKEMAAEL
EELYGDVDAVELYTGLLVEKPRQNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFG
GKVGFDIINTASLQKLVCNNVKGPCPIASFYVPNVKDSVPTTINASTAHSSQKEVNPTVI
LKERTSEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaaccgcgtcgctcctgctgtgtctctatctggggtgcttggcttgcgaagga
gccaacccctgttgctcccagccatgccagaatcgaggtgtgtgtacagaacttggcact
gatgcttatgaatgtgactgcacacgcactggatactatgggcaaaactgcacaacacct
gagctcctcacctggatcaaagtgtccctaaaaccattgccgaacacagtgcactacatc
ctcacacacttcaaaggcctatggaacatcattaacaatatttcatttatgcgggatgcc
atcatgcgttatgttctgacatcacgttcccatctgattgacagccctccaacattcaat
tccgactatggctacaagagctgggaggcctattccaacctgtcctacttcacacggacc
ttaccccctgttcctcaggattgcccaacgccgatgggtgtcgcaggtaaaaaagagcta
ccagatgtaaagatagttgcagaaaagcttctgctgagaagaaagttcatccctgacccg
cagcgaacaagcctcatgtttgcctttttcgcccagcacttttcacaccagttcttcaaa
accgacatgaagaaaggtccagccttcaccagagcaaagggccatggagttgatctgagt
cacatttatggagaagaactggaacgccagcacaagctccgactctttaaagatgggaag
ctaaaatttcagattctggatggtgaggtatacccacctactgtcagtgatgttcaggtg
gacatgcactatcctcctcacgtgcctgagtctcaccgctttgctgtgggccatgaagcc
ttcggcttggtcccaggcctcatgatgtatgcgacaatttggcttcgggaacacaaccgc
gtctgcgacattcttaaacaggagcatccggactgggatgatgagcgactcttccagact
tcaaggctgatcctcataggtgagaccattaagattgtgattgaagattatgtgcagcac
ttgagcggctaccacttcaagctcaaattcgatccagagctcctcttcaaagagcgtttt
cagtaccagaaccggatctcctctgagtttaacactctctaccactggcacccactcatg
cctgatgactttcacatccaggacgaggttttcagcttcaagcagttcatcttcaacacc
tccattttgacaaactatggggtcaataacctggtggaatcgtttaccaagcagatagca
ggaagggtggccggtggtcgtaatgttgctcctgcagtgttgatggtggcaatgaagtct
atagagaacagcagacagatgcgatatcagtcactgaacgcttacaggaagcgcttcaac
ttgaaaccctatgtctcctttgaggatatgacaggtgagaaggagatggcggcagagctg
gaggagctgtacggagacgtggacgccgtggagctatacaccggtctgctagtggagaaa
cctagacagaacgccatctttggggaaaccatggtggagatgggtgccccatactctctg
aaaggccttatgggaaaccccatttgctcccctgagtactggaagcccagcacattcggt
ggcaaagttggatttgatattataaacactgcctcactgcagaagctggtctgcaataac
gtcaaggggccgtgtcccattgcatctttttacgtgcccaatgtaaaagattcagtacca
accaccatcaacgcaagtacagcccattcaagtcaaaaagaggtcaacccaacagtaata
cttaaagaaaggacttctgagctctga

DBGET integrated database retrieval system