KEGG   Astyanax mexicanus (Mexican tetra): 103034617
Entry
103034617         CDS       T05042                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103034617 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103034617 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amex04052]
    103034617 (kitlg)
Cytokines and growth factors [BR:amex04052]
 Growth factors
  Growth factors (RTK binding)
   103034617 (kitlg)
SSDB
Motif
Pfam: SCF DASH_Dad4
Other DBs
NCBI-GeneID: 103034617
NCBI-ProteinID: XP_022539640
Ensembl: ENSAMXG00000011675
LinkDB
Position
24
AA seq 271 aa
MKKSKIWIRTCVHLLLYITVAAYSREIGNPITDDIKKISLLKQNIPKDYKITIKYLPEEV
SGTCWVNLNVFHLEESLKVLAQKFGNISSNKDNIETFVQMLREMRFHIGHTLEDDMQQFE
CHYREEKWLTARYFEFVEGFFNTANSSREEAGCDSPPCPTTTKTTISTTVTASVTHHHSR
GSSFAQNSTAEKEATNQRILPEVLERSLLSLLFIPLIGVVFLLIWKVKSRRNDPPVQRSS
EGPPLFIGAEASAPPLDDISEKNRLTLVREV
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaatttggatacgcacctgtgtccatttattactctacatcacagtt
gctgcttattccagggaaattggaaaccccataacagatgacatcaagaagatttcattg
ctgaagcagaatataccaaaagattacaagatcacaatcaagtacttacctgaagaagtg
agtggaacgtgctgggtgaatctaaatgtattccacttggaggagagcttaaaagtcctg
gcccagaagtttgggaatatttcctccaataaagacaatatagagacttttgtccaaatg
ttgcgtgagatgcggtttcatattggacacaccttggaggatgatatgcagcagtttgag
tgccactacagagaggagaagtggctaacagcacgctactttgaatttgtggaaggcttt
ttcaatactgccaattcttcgagagaagaggcaggctgtgattcccccccttgtcccaca
acaacaaaaacaacaatatcaacaacagtaacagcatcagtgacacaccatcattcacga
ggtagttcatttgcacagaacagcactgcagaaaaagaggctacaaatcagaggattctt
ccagaggtgttggagaggagcctcttgtctcttctctttattcctctcattggtgtggtc
ttcctgctcatctggaaggtgaaatccagaagaaatgacccacccgtgcaaaggagttca
gaaggccctccgctgtttattggagctgaagccagcgcgccaccattagatgacatatca
gaaaagaacagattaaccttggtcagagaggtttaa

DBGET integrated database retrieval system