KEGG   Astyanax mexicanus (Mexican tetra): 103034748
Entry
103034748         CDS       T05042                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00230  Purine metabolism
amex01100  Metabolic pathways
amex04020  Calcium signaling pathway
amex04114  Oocyte meiosis
amex04261  Adrenergic signaling in cardiomyocytes
amex04270  Vascular smooth muscle contraction
amex04371  Apelin signaling pathway
amex04540  Gap junction
amex04912  GnRH signaling pathway
amex04914  Progesterone-mediated oocyte maturation
amex04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103034748
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103034748
   04020 Calcium signaling pathway
    103034748
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103034748
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103034748
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103034748
   04914 Progesterone-mediated oocyte maturation
    103034748
   04916 Melanogenesis
    103034748
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103034748
   04270 Vascular smooth muscle contraction
    103034748
Enzymes [BR:amex01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103034748
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 103034748
NCBI-ProteinID: XP_022541047
LinkDB
Position
3
AA seq 1092 aa
MSHQPDFSVTVPDPATGGAHGTYRSSGGFSFLPSFLRLTFTPASLERVYQAYFLRQRQET
LLALLVSAMLFNCYVIIMAAVLYSPDKLATLLAAIIGLAVSVAVYILLRLRKLPDKVVRK
VVPYAAWLLITVQVLCYLGFNFAGVYEPGDAVGWQTFFTFSFLLTLPLPLSHVVLLAALS
CWTHTVLLGIVVAQRRLENLEILIRQLVANMMLYFGAMVVGVMSYFMADRKYRTAFLEAK
QSLEVSLTLDEQSTQQEELLLSILPKHIADEMLQGMKKEANQKSEAQQFNTMYMYRHENV
SILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAQYHQLRIKILGDCYYCICGLPD
YRPDHAACSIMMGLAMVKAISYVREKTKTEVDMRVGVHTGTVLGGVLGQKRWQFDVWSTD
VTVANKMESGGIPGRVHISQSTMECLSGEFELEEGNGGERCDYLMEKGIDTYLVLVPTET
STEGGLTNGVNGVTNGTVVCRNSPTLIATTQTNGSVRSVRNITADTETADTQRLQVSSRA
DGGTEDEHDLNTLLNKTLVDREMEETLEEKRTSVLSLRFVDPELETRYSLEKERQTGAAF
SCSCVVLIFTSAMEMLIDPQLTVNYVTLAIGEVLLLILTICSLAVIFPRLFSEKLVSFSL
WIDRTRWARNTWAMAAIFVLAMAEVADMLSCMQPPLLLLNSTAGFTLETLGDGGCAENPK
HYSYIAVLSLVATTMLVQVSHLVKLALMLLVTVATSAVDIYSWRDIYDIYDLIRYLEYRN
SVVPTKYLMTVMIIVMMIGLYYFARHVERQARKLFLWKIEVHDQKERVYEMRTYNEALVT
NMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTEEGINNGGIECLRILN
EIISDFDSLLDRTQFLCITKIKTIGSTYMAASGVTPESNTNGYSDRKEEDQCFLERWQHL
ADLADFALAMKVTLNNLNKQSFNSFMLRIGLNMGGVLAGVIGARKPHYDIWGNTVNVASR
MESTGVMGNIQVVEDCYKILREYGFRFVRRGPIFVKGKGELLTYFMKGKDSPPVTNGKTV
IPTLPNQIPDKS
NT seq 3279 nt   +upstreamnt  +downstreamnt
atgtcccatcaaccagacttttcggtaaccgtcccagatccggcaacaggaggagcacat
ggaacgtacagaagttcaggaggtttctcattcctcccatcattcctccgcctcaccttt
accccggcctccctcgagagagtctatcaggcctatttcctgcggcaacggcaagagaca
ctgctagcactgctagtttccgctatgctgttcaactgctacgtcatcatcatggccgca
gtgctttattcccctgataagctagccacgctgttagcggcgataatcgggctagctgtg
agcgtagcagtctacatcctcttgcggttacgtaaactgccggacaaggtggttcgtaaa
gtcgtaccatacgctgcatggctgctgatcacagttcaggtgctgtgctacctgggcttt
aactttgcaggtgtttatgaacccggggacgcagtgggctggcagacgtttttcacgttt
tccttcctactgacactgccgcttccactgtcgcatgtggttctacttgctgcgctgtcg
tgctggacgcacacggtgttgctggggattgtggtggcgcaacggcggctggaaaaccta
gaaatactgatcagacagcttgttgcaaatatgatgctgtattttggtgcgatggttgtg
ggcgtgatgtcatatttcatggctgatcgcaaataccgcacagcctttctggaggcaaaa
cagtcactggaggtcagtctgacactcgatgagcagagcacgcaacaggaggagttgttg
ttgtccatcttgccgaagcacatagcagatgagatgctgcagggaatgaagaaagaggcc
aatcagaaatcagaagctcagcagttcaacaccatgtacatgtacagacacgaaaatgtc
agtatcctctttgctgatattgtgggatttactcagctctcgtcggcctgcagcgctcag
gaactcgtaaaactgctcaatgaactctttgcccgctttgacaaactagcagctcaatat
caccagttgaggataaagattctgggggactgttattattgtatctgtggattacctgat
taccggccagaccacgcagcctgctccatcatgatgggcctggccatggttaaggccatc
tcgtacgtacgcgagaagacaaagacggaggtggacatgcgtgtgggggtgcacacaggg
acggtgctgggcggagtcctgggacagaaacgttggcagtttgatgtatggtccaccgat
gtcaccgtggccaataagatggagtctggtggcatcccaggacgtgtgcacatctcccag
agtacgatggagtgtttgagcggagagtttgagctggaggaggggaacggaggagagcgc
tgcgactatctgatggaaaaaggtatcgacacttacctggtgctcgtgcccaccgaaacc
agtacagagggtgggctgacgaacggagtaaacggggtcacgaatggaactgtggtctgt
aggaactcgcccaccctcatcgccaccactcagaccaacggcagtgtgcgttcagtccgc
aacatcacagcagacacagagacggccgacacacagaggctgcaggtgagcagccgggca
gacggagggacggaagacgagcatgacctgaacacactgctgaataaaactctagtggac
agagagatggaggaaaccctggaagagaaacggacgtctgtgctctctctgcggtttgtg
gaccctgagttggagactcggtactcactggagaaagagaggcagactggagcggcgttc
agctgtagctgtgtggttctgatcttcacctctgccatggaaatgctcatagacccacag
ctgacagtgaattatgtaactctggcgattggagaggtgctgctcctcattctcaccatc
tgctcactggcggtcattttcccacggttgttctcggagaagttggtgtcattctctctg
tggattgatcggactcgctgggcgagaaacacctgggcaatggcagcaatctttgtcctg
gccatggctgaggtggcagacatgctgagttgcatgcagccccccctgctgttgctgaat
tccactgcaggttttactctggaaactctgggcgatgggggctgcgctgagaaccccaaa
cactacagctacattgccgtgctctcgctggtggccaccaccatgctggtgcaggtcagc
cacctggtcaaactcgcactaatgctgctagttactgtggcaaccagcgcagtggacatc
tacagctggagggacatttatgacatttacgacctcatacgttacctggagtacaggaat
tctgtggttcccactaaatatctgatgacagtgatgatcattgttatgatgattggattg
tactactttgctcggcatgtggagaggcaggcccggaagttgtttctatggaagattgag
gttcatgatcagaaggagcgagtgtacgagatgaggacatataacgaggctttggtcacc
aacatgctgcccgaacacgtggccagacacttcctgggctcaaagaaacgggacgaggag
ctgtacagtcaatcctatgatgaaattggtgtgatgttcgcctcaatcccaaacttttct
gatttctacacggaggagggcatcaataatggcggcatcgagtgtctaagaattcttaat
gaaatcatctcagactttgattctctgctggaccgtacacaatttctctgcatcaccaaa
attaagacgattggcagcacctacatggcagcatcgggcgtaacacctgagagcaacacc
aacggatatagcgaccgcaaagaagaggatcagtgttttctggagcgatggcagcacctg
gctgatttggctgattttgctttggccatgaaggtcaccctaaataacctcaacaagcaa
tccttcaacagcttcatgcttcggattgggctgaatatgggtggtgtgttggctggtgtg
attggagcacgtaaaccacactatgacatctggggtaacactgttaatgtggccagccgc
atggagtccactggagttatgggtaatatacaggtggtggaggactgctacaagatactg
cgggagtatgggttccgctttgtgaggagaggccccatctttgtgaaaggaaaaggagag
ctgctcacttacttcatgaaggggaaggacagcccccctgttactaatggcaagacagtc
atccccactctgcccaatcagataccggacaagtcctga

DBGET integrated database retrieval system