KEGG   Astyanax mexicanus (Mexican tetra): 103035285Help
Entry
103035285         CDS       T05042                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex03030  DNA replication
amex03410  Base excision repair
amex03420  Nucleotide excision repair
amex03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:amex00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103035285 (lig1)
   03410 Base excision repair
    103035285 (lig1)
   03420 Nucleotide excision repair
    103035285 (lig1)
   03430 Mismatch repair
    103035285 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:amex03032]
    103035285 (lig1)
   03400 DNA repair and recombination proteins [BR:amex03400]
    103035285 (lig1)
Enzymes [BR:amex01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103035285 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103035285 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103035285 (lig1)
DNA replication proteins [BR:amex03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103035285 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103035285 (lig1)
DNA repair and recombination proteins [BR:amex03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103035285 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     103035285 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     103035285 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 103035285
NCBI-ProteinID: XP_022521263
LinkDB All DBs
Position
Unknown
AA seq 994 aa AA seqDB search
MQRSIASFFQPMKCKEKKDEPAKVKSEPIKSPLKTQNGERDCDSPVKKTSKRARAIIDSD
DEEQPTVKNEVSKQEEEQATKPDKEKADVKVSASPLSPKPLATPTTPATPATPALSAASG
TPGTPATPNSTSPSGIPKRRTARKHFPKRKLDSRSDGEKEKEEAEEDGKKKEEQQESKRA
RIEESADQTENEGEEMEVEDKTVNGESAAEDQKSNDEEKMDEGETNDTNEESKKSDDEKV
KKEKKEGRKEKNKMKVNTVKEEKNSPERVKKEQKNGEEEKKEGSAKKKPISSFFAPRKAA
VKLEKSEEKNDGEKKKDEGKSSPVSEEKGKKSEKGAEPANQSQYDPSKAHYHPIDDACWK
KGQKVPYLAVARTFEKIEEDSGRLRNIETLSNLLRSVILLSPDDLLCCVYLCLNQLGPAY
QGLELGVGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPASLNAA
GVFNKLKEIGNMSGNSAMNKKIDIIKGLFVACRFSEARFIVRSLAGKLRIGLAEQSVLAA
LSQAVCLTPPGQEFPPSVIDAGKGMSTESRRAWLEEKALILKQTYCEMPNYDVIIPVLVK
EGIDQLPKHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHILENG
EVRIFSRNQEDNTSKYPDIISRIPQVKKESVRCCVLDTEAVAWDREKKQIQPFQVLTTRK
RKDVDASEIKVQVCVYAFDLLYLNGESLVREPLSRRRALLKESFVEKEGEFVFARSLDSD
NTDTIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLEGVGDTMDLCVI
GAYLGKGKRAGSYGGFLLACYDEENEEFQSVCKIGTGFKDEDLEQHYNFLKEHILPKPRP
YYRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGLVDSEKGISLRFPRFLHIREDK
KPEDATTGAQIADLYKKQQQIQNQGEKADLEDYY
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtagcatcgcgtcttttttccagccgatgaaatgtaaggagaagaaagacgaa
ccagctaaagtgaagtctgaaccaatcaaaagcccactgaaaactcagaatggtgagaga
gactgtgattctcctgtaaagaagacaagcaaacgagctcgagcgatcatcgacagtgat
gatgaagaacagccgacagtaaagaacgaggtctccaagcaggaggaagaacaagctacc
aagccggacaaggagaaggccgatgttaaagtcagtgccagtccactttcaccaaagccc
ctcgctaccccaacaacccctgccacgccggcaactccagcattatctgcagcttcaggc
acacctggaactcctgctactccaaattccacctcaccctctggaattccaaaacgcagg
actgctcgtaagcatttccccaagaggaagttggacagcaggagtgatggagaaaaggag
aaagaggaggccgaagaggatggaaagaagaaagaagaacagcaggagagtaaaagagca
aggatagaggagtctgctgatcagacagagaatgaaggagaggaaatggaagtggaagat
aagaccgtaaatggtgagagtgcggcagaagatcagaaatcaaatgatgaggaaaagatg
gatgaaggagaaactaatgacacaaatgaagagtccaagaaatcggatgatgaaaaggtt
aaaaaagaaaaaaaggagggaaggaaggagaagaataaaatgaaagtgaatacagtcaag
gaggaaaaaaacagtcccgaaagagttaagaaagaacagaagaatggagaggaggagaag
aaagagggatctgctaagaaaaaacccatcagcagtttttttgcccccagaaaggctgca
gtaaagctggaaaaatcagaagaaaaaaatgatggtgagaaaaagaaggacgaagggaag
agttcgcccgtctctgaggagaaagggaagaaaagtgaaaagggggcggagcctgcaaac
cagagccagtatgatccttctaaagctcattaccatcccattgatgatgcgtgctggaag
aagggacagaaagttccgtatctggctgttgctcgtacctttgagaagattgaggaagat
tccggcaggttgaggaacatcgagacgctgtccaacctgctgcgatccgtcatcctcctc
tctccagatgatctgctgtgctgtgtgtacctgtgcctgaatcagcttggtccagcctac
caggggctggagctgggtgttggagagacggtgctgatgaaggctgttgcccaggcaacc
gggcgacagctggacaaaatcaaggcagaggcccaggagaaaggcgacctgggattggtg
gccgagagttcccgcagcaaccagcggatgatgtttgctccagccagtctgaatgcagca
ggagtcttcaacaaactgaaggaaatcgggaacatgagcggcaactctgctatgaataag
aaaattgacatcattaagggtctgtttgtggcttgtcgtttctcagaggccagattcatt
gtacggtcgttggcagggaagctgaggatcggattggctgagcagagtgtgctggcagct
ctgagtcaggctgtgtgtctgaccccaccaggtcaagagttcccgccgagtgtgattgat
gctgggaaggggatgagcacagagagccggagggcgtggctggaggagaaggcactcatt
cttaaacagacttactgtgaaatgccaaattatgatgtcatcatccctgtcctggtaaag
gagggaatagaccagctgcccaagcactgcaaactgactccaggtgtgcccttgagaccc
atgttggctcaccccactaaaggagtcggggaggtgatgaagaggtttgatgaggctgct
ttcacctgcgagtacaagtatgatggagagagagcacagatccatattcttgaaaatgga
gaggttcggattttcagcagaaatcaagaagacaataccagcaaataccccgatattatc
tcacgcatcccacaggtaaagaaggagtcggtgcgttgctgtgtgttggacacggaggct
gttgcgtgggacagagagaaaaaacagatccagcctttccaggtcctcactacgcgcaag
aggaaggatgtagatgcgtctgagataaaggtgcaggtgtgtgtgtacgccttcgacctg
ctgtacctgaacggagagtctctggtgcgggagccgctgagtaggcgccgcgctctgctg
aaggagagttttgtggagaaggagggagagtttgtcttcgctcgttctctcgactctgac
aacactgacaccatcgctgagttcctggagcagtctgtacgagactcttgtgaaggctta
atggtgaaaaccctggagaaagacgccacttacgaaatcgccaagcgctcccacaactgg
cttaagctgaagaaggattatctggagggcgtgggggacactatggatctgtgtgtgatc
ggggcctacctggggaaaggcaagagggcgggcagctatggaggattcttgctggcctgc
tatgatgaggagaacgaggagtttcagtcagtttgtaagattggaacaggattcaaggat
gaagatctggagcaacattacaatttcttaaaggagcacatcctccctaagccccggccg
tattaccgggtggatcagtcagcagaacccgatgtgtggctggatgcagtgcaggtgtgg
gaggtgaaatgtgctgacctctcgctgtctccagtctacaaggcggcaatgggcttggtg
gactcagagaaaggaatttctctacgcttcccacgattcctccacatcagagaagacaag
aagccagaggatgccactactggagcacagattgctgatctctataagaagcagcagcag
attcaaaatcaaggggaaaaggcagatctggaggattattactga

DBGET integrated database retrieval system