KEGG   Astyanax mexicanus (Mexican tetra): 103036383Help
Entry
103036383         CDS       T05042                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00010  Glycolysis / Gluconeogenesis
amex00053  Ascorbate and aldarate metabolism
amex00071  Fatty acid degradation
amex00280  Valine, leucine and isoleucine degradation
amex00310  Lysine degradation
amex00330  Arginine and proline metabolism
amex00340  Histidine metabolism
amex00380  Tryptophan metabolism
amex00410  beta-Alanine metabolism
amex00561  Glycerolipid metabolism
amex00620  Pyruvate metabolism
amex01100  Metabolic pathways
Module
amex_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103036383 (aldh2)
   00053 Ascorbate and aldarate metabolism
    103036383 (aldh2)
   00620 Pyruvate metabolism
    103036383 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103036383 (aldh2)
   00561 Glycerolipid metabolism
    103036383 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103036383 (aldh2)
   00310 Lysine degradation
    103036383 (aldh2)
   00330 Arginine and proline metabolism
    103036383 (aldh2)
   00340 Histidine metabolism
    103036383 (aldh2)
   00380 Tryptophan metabolism
    103036383 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103036383 (aldh2)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103036383 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103036383
NCBI-ProteinID: XP_022541281
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MLRAALTRACPLLPAAPRLAACRYSAAAIPAPNPQPDVHYNKLFINNEWHDALSKKTFPT
INPSTGEVICEVAEGDKADVDKAVKAARDAFRLGSPWRRMDASRRGVLLNRLADAVERDA
GYLAELETLDNGKPFSVAYSVDVPMVVKCLRYYAGWADKWEGKTVPIDGDFFCYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNTIVMKVAEQTPLTALYVASLIKEVGFPPGVVN
IISGLGHTAGAAISSHMDVDKIAFTGSTEVGHIIQQAAGASNLKKVTLELGGKSPNIILS
DANMEEAVEQAHMAIFFNMGQCCSAGSRTYVQESIYNEFVERSVERAKKRVVGNPFDLKT
DQGPQVDDEQFKKILGYISSGKKEGAKLMYGGGVAADRGYFIQPTVFGEVQDDMKIAREE
IFGPVMQILKFKTIEEVIERANDTNYGLAAAVCTTDINKAHYISNSLRAGTVWINCYNVF
GVQAPFGGYKASGTGREMGEYGLEAYTEVKTVTTKIPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgccgcactgacccgagcctgcccgctcctgcccgccgctccccggctcgca
gcctgccgctactccgctgcagcgatccccgctcccaacccgcagcccgacgtccattat
aacaagctcttcattaacaatgagtggcatgatgccctgagcaagaaaaccttccccacc
atcaacccatctactggagaggtcatctgcgaggttgcagagggagataaggcggacgtg
gataaagcagtgaaggctgccagagatgccttcaggctggggtctccatggagacgaatg
gacgcatcgaggcgcggggtgctcctgaaccgcctggctgatgctgtcgagagagacgcc
ggctacctggctgagctggagactctagacaatggaaagccgttttccgtggcctactct
gttgatgtgcccatggtggttaaatgcctgaggtactacgctggctgggcagacaaatgg
gagggtaagacagttcccattgatggtgatttcttctgttacacccgacatgagcctgtt
ggagtgtgtggccagattattccttggaacttccctctgttgatgcaggcgtggaagctc
ggtcctgctctggcaactggcaacaccatagtcatgaaagtagcagaacagacgcctctc
actgcactctacgtggccagcctcatcaaggaggtgggcttccctcctggtgttgtgaac
atcatctctggactgggtcatacagctggagctgccatttcttctcacatggatgtggac
aaaattgcctttactggctccacagaggtaggtcacattatccagcaagctgctggcgca
agcaacctgaagaaagttactctggaacttggagggaagagtcccaatattattttgtct
gatgccaacatggaggaagctgtggagcaggcccatatggccatcttcttcaacatgggt
cagtgctgctctgcaggctctcgtacctatgtgcaggagagcatctacaatgagtttgtg
gagcgtagtgtggagagagcaaagaagagggtggtggggaatccctttgaccttaagact
gaccagggtccacaggtcgatgatgaacagtttaagaagatcttgggttacatcagcagt
ggcaagaaggaaggtgcgaagctgatgtatggaggcggtgtggctgcagaccgtggttac
ttcatccagcccactgtatttggagaagttcaggacgacatgaaaattgcccgtgaagag
atctttgggccagtaatgcagattctgaagtttaagactatagaggaggtgatcgagagg
gccaatgacaccaattatgggctggctgctgctgtctgcaccactgatatcaacaaagca
cattacatctctaacagtctccgtgctggaacagtctggattaactgctacaatgtgttt
ggagtccaggctccctttggtggctacaaggcctcaggtactgggcgtgaaatgggagag
tatggcctggaagcgtacactgaagtcaaaactgtaacaactaaaatcccccagaaaaat
tcctaa

DBGET integrated database retrieval system