KEGG   Astyanax mexicanus (Mexican tetra): 103036754Help
Entry
103036754         CDS       T05042                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:amex00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103036754 (sod1)
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103036754 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103036754
NCBI-ProteinID: XP_015460818
Ensembl: ENSAMXG00000008618
LinkDB All DBs
Position
20
AA seq 153 aa AA seqDB search
MVHKAVCVLKGTGEVTGTVFFEQGDGAPVKVSGEITGLTPGLHGFHVHAFGDNTNGCISA
GPHYNPYNKTHGGPTDEIRHVGDLGNVTAGADGVAKINIEDKMLSLSGPHSIVGRTMVIH
EKEDDLGKGGDEESLKTGNAGGRLACGVIGIAQ
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtgcataaggctgtgtgtgtgctgaaggggaccggagaggtgaccggaacggtgttc
tttgagcagggtgatggtgctccagtaaaggtttcaggtgagatcactggcctcactcct
ggcctgcacggatttcacgtccatgcttttggagataacacaaatggttgcatcagtgct
gggccacactataacccatacaacaaaacccatggtggacctactgatgaaatcagacat
gttggagatctgggtaatgtgacagctggggctgatggtgttgctaaaataaacattgag
gataaaatgttgtctctgtcagggccacactcaatcgttggaaggaccatggtgatccat
gagaaagaggatgacctgggaaaaggcggcgatgaagaaagtctcaaaactgggaacgcc
ggtggtcgcttggcctgcggtgtgatcggcatcgcccagtga

DBGET integrated database retrieval system