KEGG   Astyanax mexicanus (Mexican tetra): 103036930
Entry
103036930         CDS       T05042                                 

Gene name
braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04012  ErbB signaling pathway
amex04068  FoxO signaling pathway
amex04150  mTOR signaling pathway
amex04270  Vascular smooth muscle contraction
amex04510  Focal adhesion
amex04810  Regulation of actin cytoskeleton
amex04910  Insulin signaling pathway
amex04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103036930 (braf)
   04012 ErbB signaling pathway
    103036930 (braf)
   04068 FoxO signaling pathway
    103036930 (braf)
   04150 mTOR signaling pathway
    103036930 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103036930 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103036930 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103036930 (braf)
   04914 Progesterone-mediated oocyte maturation
    103036930 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103036930 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103036930 (braf)
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103036930 (braf)
Protein kinases [BR:amex01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   103036930 (braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 103036930
NCBI-ProteinID: XP_007259826
Ensembl: ENSAMXG00000011513
LinkDB
Position
7
AA seq 880 aa
MTTLGWLSGLNRLVFTLPVLSQFTPAQLSVFSRLESVSPSCLDPRCLSSIIFHSVSRSVK
MAALSSAESPPPVFNGDPMDRDAEREAGLEELGTGLASTCSGGIPEAQQDIPEEIWNIKQ
MIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAIGNGTEFCSS
PTPSPLEMKLVASQSLPAAPNTLAVLQTPTDAARGNPRSPQKPIVRVFLPNKQRTVVPAR
CGMTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLLAS
KFLVHHPITQEEVSSEGTTPVSEVCPSIPPSDSTGSLCHPSVSPSKSIPIPQSFRPGEED
HRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLQRSEGGSTTGLSATPPASLPGSLT
NVKVPQKSPCQQRERKSSSSSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGSGSFGTV
YKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQLAIVTQW
CEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVK
IGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIVLYELMS
GALPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMADCLKKKREERPLFLRSW
PPLSFWHALYPRSTAAPLNRLSTAPASRPKTSVCTPALLQKHPFRLEATENFQRLSSATS
STVHPSSLFKNVLCSYSGFIHKNRKKHLVSKNVLFFFLFT
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgactacattaggttggttatctggtctgaatcgtctggttttcactctcccagttctc
tcccagttcaccccagcgcagttgagtgttttttcgcgtcttgagtctgtctccccctcc
tgtctcgatcctcggtgtctctcctcgattattttccactcagtttctcgcagtgttaaa
atggcggcgttgagcagcgccgagtccccaccgcccgtcttcaacggagaccccatggac
cgcgatgcggagcgggaggccgggctggaggagctgggcacggggctggcctccacctgc
tccggggggatccccgaggctcagcaggacattcccgaggagatatggaacatcaaacag
atgattaagctgactcaagagcacatagaggcacttctggacaagtttggcggtgaacac
aaccctccgtccatatacctggaggcttatgaagagtataccagtaagcttgatgcgctg
caacagagggagcagcagctgctggaggcaatcggaaacggaactgagttctgctcctct
cccacccccagcccgctggagatgaagctagtggcttctcaaagtctccctgctgcccca
aataccctggctgtgctgcagacccccaccgacgctgcccgcggcaaccctcgctcaccc
cagaaacccatcgtcagagtctttctgcccaacaaacagaggacagtggtcccggcgcgc
tgcgggatgaccgtaagggactctttgaagaaggctctcatgatgcgaggcctgatccca
gaatgctgtgctgtctacaggattcaagatggggagaagaagcccattggttgggacaca
gacatctcttggttgacaggagaggagctgcatgtggaggttttggagaatgtgcccctg
acaacccataattttgtgaggaagaccttctttacgttggccttctgtgacttctgccgg
aagctgctgttccagggcttccgctgccagacgtgtggctacaagttccaccagcgctgc
agtaccgaggtcccgcttatgtgtgtcaactatgaccagctggatttattactggcgtcc
aagttcttagtgcaccaccccattacccaggaggaggtgtcatcggagggcaccacccct
gtgtcagaagtgtgtccgtccatcccgccatctgactccacaggatcgctgtgccatccg
agtgtgtccccgtccaaatccatccccatcccacagagtttccggccaggagaggaagac
caccgtaaccagtttggccagagagatcgttcttcctcagcccccaacgtccatatcaac
acaatcgagccagtcaacattgatgacttgattcgtgatcaaggtttgcagagatcagaa
ggaggctccactactgggctgtcagccacaccccctgcctccctgcctggttccctgacc
aatgtgaaggttccgcagaagtcgccctgccaacagcgggagcgcaagtcgtcgtcctcg
tccgaggaccgcaataaaatgaaaacgctgggccgacgggactctagtgacgactgggag
attccagagggtcagatcactttgggccagcggataggatctggttcttttggaaccgtc
tacaaggggaaatggcacggcgacgtggcagtaaagatgttgaatgtcactgcacctact
cctcaacagctacaggccttcaagaatgaagtgggggtcctcaggaaaactcggcacgtc
aatattctgctcttcatgggttacaccaccaagccccagctggctatcgtcacacagtgg
tgcgaaggctccagcctctaccatcacctgcacattatcgagaccaagtttgagatgatc
aaactgattgacatcgcccgtcagacggcccagggcatggactaccttcatgccaagtct
atcattcatagagatctgaagagcaacaatatcttcttacatgaagatcttacggttaag
attggtgatttcggtctggccacagtgaagtcccgctggagtggatcacaccagtttgag
cagctgtcaggctcgatcctgtggatggctcctgaggtgatccggcttcaggataagaat
ccatacagctttcagtcagacgtctacgcctttggcatcgttctgtatgagctcatgtcg
ggggcattgccttactccaacataaacaacagagaccagatcatcttcatggtgggccgg
ggttacctgtcccctgacctgagcaaggtgcgcagcaactgccccaaggccatgaagaga
ctcatggctgactgcctgaagaagaagagagaggagcggcccctcttcctcagatcctgg
cctccattgagcttttggcacgctctctacccaagatccaccgcagcgcctctgaaccgt
ctctcaaccgcgccggcttccagaccgaagacttcagtctgtacgcctgcgcttctccaa
aaacacccattcaggctggaggctacggagaattttcagcgtttaagtagtgccaccagc
tcaacagtccatccctcgtcactttttaaaaatgtcttgtgttcctacagtgggttcatc
cataaaaacagaaaaaaacacctagtttcaaagaatgtgctgtttttcttcctctttacc
tga

DBGET integrated database retrieval system