KEGG   Astyanax mexicanus (Mexican tetra): 103037183
Entry
103037183         CDS       T05042                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04080  Neuroactive ligand-receptor interaction
amex04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103037183 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103037183 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:amex04030]
    103037183 (lpar2)
G protein-coupled receptors [BR:amex04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    103037183 (lpar2)
SSDB
Motif
Pfam: 7tm_1 7tm_4 CoA_binding_3
Other DBs
NCBI-GeneID: 103037183
NCBI-ProteinID: XP_007229118
Ensembl: ENSAMXG00000017570
UniProt: W5LE24
LinkDB
Position
Unknown
AA seq 349 aa
MPSEECEGLGQNVSFFYSQTNKTISEQWKSIDFVVVGLGVPVCFLIILANLMVMVAILVN
RSFHYPVYYLLGNMAAADLFAGISYFNLIFHTGPWTITLSQQQWFVRGALIEMSLTASVL
NLLAVALERHQTIFTMQLHSTMSNRRVLLLIVFIWVVAIIMGLVPTMGWNCVCQTSLCST
VAPLYSRSFLVFWALLNLLTFSIMVAIYTRIFVYVRRKNQSMTLCMVQDKTGDTLVSLMK
TVSMILGAFVICWTPGLVILLLDGLNCSECQVLKYEKYCLVLAECNSLVNPIIYSCRDKE
MRKTFKRILCFLCRRGIDPESEPPNVQSDTLKRERLLKEKYPENFTNTL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgccctctgaggagtgtgagggccttgggcagaatgtctcgtttttctactctcagact
aataagaccatcagcgaacagtggaagtcgatcgactttgtggtggtggggctcggggtc
ccggtctgcttcctcatcatcctcgccaacctgatggtgatggtggccatcctcgtgaac
cgcagcttccactaccccgtctactacctgctggggaacatggcggccgccgacctcttc
gctgggatctcctacttcaatctcatatttcacactggcccgtggaccatcacgctgagc
cagcagcagtggttcgtccgcggagctctgatagagatgagcctgaccgcctctgtgctc
aacctgctggccgtggctttagagcgccatcagaccatcttcaccatgcagctccacagc
accatgtccaaccgccgcgtgctgctgctcatcgtgttcatctgggtggtggccatcatc
atgggcctggtgcccaccatgggctggaactgtgtgtgccagacctccctgtgctccacc
gtggctccgctctactctcggagcttcctggtgttctgggccttgctcaacctcctcacc
ttctccatcatggtggccatttatacgcgcatttttgtgtatgttcggcggaagaaccag
agcatgacgctgtgcatggtccaggacaagaccggggacacactcgtgagcctcatgaag
accgtctccatgattctgggcgccttcgtgatctgctggactccgggtctggtcattctg
ctgctggacgggctgaactgttcagagtgtcaggttctgaaatacgagaagtactgtctg
gttctggccgagtgcaactccctggtgaaccccatcatctattcgtgccgagacaaggag
atgaggaagaccttcaaacgcatcctgtgcttcctctgcaggagagggattgacccggag
agcgagccccccaacgtccagagcgatactctaaaaagagagcgtctgctgaaggagaaa
tacccagagaacttcaccaacactctgtga

DBGET integrated database retrieval system