Astyanax mexicanus (Mexican tetra): 103037668 Help Entry 103037668         CDS       T05042                                  Name (RefSeq) histone H2A.V isoform X2   KO K11251   histone H2A Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex03082   ATP-dependent chromatin remodeling amex04217   Necroptosis Brite KEGG Orthology (KO) [BR:amex00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103037668  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103037668  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:amex03036]     103037668   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:amex04147]     103037668 Chromosome and associated proteins [BR:amex03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103037668 Exosome [BR:amex04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103037668 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103037668 NCBI-ProteinID:  XP_007238208 Ensembl:  ENSAMXG00000007791 UniProt:  A0A8B9K742 A0A3B1KKN2 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggccggaggcaaggcaggaaaggacagcggcaaagccaaggcgaaagcagtgtctcgc tcacagagggctggacttcagttccctgtgggtcgtatccacaggcacttgaagacccgt actaccagccatggacgtgtgggggctacagcagcagtgtacagtgctgccatccttgaa tacctgacagctgaggtgctggagttggcaggcaatgcttccaaagatctgaaggtgaag cgtatcactccacgccatttacagctggccatccgtggagatgaggagttggactccctc atcaaggctaccatcgctggtggtggtgtgatccctcacatccacaagtctctgattggc aagaagggccagcagaagactgcataa

DBGET integrated database retrieval system