KEGG   Astyanax mexicanus (Mexican tetra): 103037950
Entry
103037950         CDS       T05042                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103037950
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103037950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amex04052]
    103037950
Cytokines and growth factors [BR:amex04052]
 Growth factors
  Growth factors (RTK binding)
   103037950
SSDB
Motif
Pfam: SCF DUF1180
Other DBs
NCBI-GeneID: 103037950
NCBI-ProteinID: XP_007252425
Ensembl: ENSAMXG00000009632
LinkDB
Position
7
AA seq 267 aa
MKKAKISGSACVLVLLFSSLVSCSGVFGSPLTDDVATLDTLRENLPEDYKIPVRFISKDV
GGTCWLHLNLFPLEISLKALALKFGNLSTNRENITIFITMLQGLRFTVDNEELEATMQVF
KCHYQSESWSTRRYFDHVKEVLGAFASAPRQFHCIPPPCPTVPPITPGQDSQKEVIDGVV
PSLLALLVISCIATLALALRTVILRKACCAKRRYETDVNRFPGPERSETQSDPEDGSIAS
HNDPESSPLHKQCRAQQDSLGSEDTGV
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaagaaggctaagatcagtggaagtgcatgtgtgttagtcctgctgttttcgagcctt
gtatcctgttctggtgtttttgggagccctctgacagatgatgtggccactttagacaca
cttagagaaaatcttccagaggattacaaaattccggttcgtttcatttctaaagacgtg
ggagggacgtgctggcttcatctcaacctgtttccactggagatcagtttaaaggcgcta
gccctcaagtttggcaacctttccaccaacagagaaaacattacaattttcatcaccatg
cttcaagggcttcgcttcactgttgacaacgaggagctggaggcgacaatgcaggtcttc
aagtgccattaccagagtgagagctggtccaccaggcgctattttgaccacgtcaaggag
gttctcggggcgtttgcctcggcacctcgccagtttcattgtatccctcccccctgccct
acggttcctcccattacgccaggacaagatagccagaaggaggtgattgacggcgtggtt
cccagccttctggctttgctcgtcatctcctgcattgccacgctggcacttgctctcaga
acagtaattctccggaaagcgtgctgtgcgaagaggagatacgaaacagacgtgaacagg
tttcccggacctgagagatcggagacacaaagtgaccctgaggatggaagcatagcctca
cacaatgaccctgaatcatctccactacacaaacaatgcagggcgcagcaggatagtttg
gggtcggaagacacaggagtttaa

DBGET integrated database retrieval system