KEGG   Astyanax mexicanus (Mexican tetra): 103038352Help
Entry
103038352         CDS       T05042                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00010  Glycolysis / Gluconeogenesis
amex00030  Pentose phosphate pathway
amex00051  Fructose and mannose metabolism
amex00052  Galactose metabolism
amex01100  Metabolic pathways
amex01200  Carbon metabolism
amex01230  Biosynthesis of amino acids
amex03018  RNA degradation
Module
amex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103038352
   00030 Pentose phosphate pathway
    103038352
   00051 Fructose and mannose metabolism
    103038352
   00052 Galactose metabolism
    103038352
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103038352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amex01009]
    103038352
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amex03019]
    103038352
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103038352
Protein phosphatases and associated proteins [BR:amex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103038352
Messenger RNA biogenesis [BR:amex03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103038352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103038352
NCBI-ProteinID: XP_007246803
Ensembl: ENSAMXG00000012908
UniProt: W5L0B1
LinkDB All DBs
Position
15
AA seq 786 aa AA seqDB search
MAQMQTAGADPTKMGIGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVFFVHEGYQGL
VDGGDNIRPATWESVSMMLQLGGTVIGSARCKDFQTREGRIKAAYNLVKRGITNLCVIGG
DGSLTGANLFRTEWSGLLGDLVSKGKITGDEAKSASHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIMEVVDSITTTAQSHQRAFILEVMGRHCGYLALVTALACGADWVFIPEMPPDDG
WEEHLCRRLMETRNRGSRLNVIIVAEGAMGRDGKPITCDQIKELVSKRLGYDTRATILGH
VQRGGTPSAFDRILGSRMGVEAVMALLEATPDTPACVVSLSGNQAVRLPLMECVQVTKDV
TVAMKEGRYDDAVKLRGRSFENNWNTYKLLAHVHLPETKSNINVAILNVGAPCAGMNAAV
RAAVRIGIIQGHNMLAVHDGFEGLAQGKIEPINWNSVGGWTGKGGSVLGTKRVLPAKHIE
EISLNIAKHNIHALVIIGGFEAFSGGLELVQARQKYEELCIPMVVIPATVSNNVPGSDFS
IGADTALNTITSTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMSGLAAGADAAYIYEDK
FGIRDLEANVEHLVEKMKTTVKRGLILRNENCNANYTTDFIFNLYSEEGKGIFDCRKNVL
GHMQQGGTPTPFDRNFATKMGAKSVLWLTEKLKECYRHGRIFANSADSACVLGMKKRGLM
FQALAELKEETDFEHRIPKTEWWLKLRPILKILAKYKISLDTTEHAHMEHIISKRGPVAL
SGKMKE
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatgcagactgcaggagcagaccccaccaagatggggattggacgtgccatc
gctgtgctgacatcaggaggtgatgctcaaggaatgaatgctgcagtgagggccacagtc
agagtcggcctgtacacaggagccaaagtcttcttcgttcacgagggctaccagggcctg
gtcgatgggggagataacattcgtccagctacctgggagagtgtgtccatgatgctccag
ttgggaggcactgtgattggcagtgctcgctgtaaggatttccagacccgtgagggcaga
ataaaggctgcttacaacctggttaaaagaggcataaccaacctgtgtgtgatcggtgga
gacgggagtttgacaggtgctaacctgttccgtacagagtggagcggcttgctgggagat
ttagtcagcaaaggaaagatcacaggagatgaggccaagtcagcatcacatctgaacatt
gtcggaatggtgggatctattgacaatgacttctgcgggacagacatgaccatcggcaca
gactctgctctccatcgcatcatggaggtggtggacagcatcaccaccacagcccagagc
caccagcgtgccttcatcctggaggtcatggggaggcattgtgggtacctggctctggtc
actgcgttagcatgtggggctgactgggtgtttattcctgagatgccccctgatgatggc
tgggaggaacacttgtgcaggaggctgatggagaccagaaacagggggtccaggctgaat
gtgattatcgtggctgagggagcaatgggcagagatggcaaacccatcacctgtgatcag
attaaagagctagtatcgaagaggctggggtatgacacacgtgccacaatcctgggtcac
gtgcagcgtggtggaactccttcagcttttgacagaattttgggcagcaggatgggtgtg
gaggctgtgatggctctgctagaagcgactccggacacaccggcgtgtgtggtcagtctg
tcagggaatcaggcggtcagactgccgctgatggagtgtgtgcaagtgaccaaggatgtg
actgtggccatgaaagagggcagatatgacgacgccgttaaactcagaggaaggagcttt
gagaacaactggaacacgtataagcttctggctcatgtacatcttccagagaccaaaagt
aacattaacgtggctatcctgaacgtgggggctccctgtgctggcatgaatgcagctgtg
cgagctgcagtcagaatcgggatcatccagggccacaacatgctggcggtgcacgacggc
ttcgagggcttagcccagggaaagattgaacctatcaattggaacagtgttggtggctgg
actggaaaaggaggctcagttttgggcaccaaaagagttcttccagccaaacacatagag
gagataagtctgaacattgccaagcacaacattcacgctctggtcattattggaggtttt
gaggcgttttcaggtggtctagagctggtccaggccagacaaaagtatgaagaactgtgc
atccccatggtggtcatacctgctactgtctctaataacgtgcctggatcagactttagc
attggagccgatactgccctgaacacaatcacctcgacctgtgacaggattaagcagtca
gctgctggcactaagaggcgtgtgttcatcattgagactatgggaggttattgtggttat
ctggccaccatgtccggtctcgctgcaggtgcggacgccgcctacatctatgaggacaaa
ttcgggattcgggatttagaggcgaatgtagagcatctggtagagaaaatgaagacaaca
gtcaagagaggcctgattcttagaaatgagaactgtaatgccaactatacaactgacttc
atcttcaacctgtactcagaggaaggaaagggcatatttgactgccgtaagaatgtctta
ggacacatgcagcagggtggaactccaaccccatttgacagaaactttgccactaagatg
ggggcgaagtctgttctctggctaactgagaagctgaaagagtgttacagacatgggcgt
atttttgctaacagtgcagactctgcgtgtgtgctggggatgaagaagagagggctgatg
ttccaggctttggctgaactgaaggaggaaacagattttgaacatcgaattccaaagact
gagtggtggctgaagttgagacccattctgaagatcttggccaaatacaagatcagtctg
gacaccacagaacacgctcacatggagcacattatcagcaagagaggtccggtggcctta
tccggaaaaatgaaagagtga

DBGET integrated database retrieval system