KEGG   Astyanax mexicanus (Mexican tetra): 103039344Help
Entry
103039344         CDS       T05042                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103039344 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:amex03036]
    103039344 (setd2)
Enzymes [BR:amex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103039344 (setd2)
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103039344 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW AWS
Motif
Other DBs
NCBI-GeneID: 103039344
NCBI-ProteinID: XP_007256565
LinkDB All DBs
Position
10
AA seq 2886 aa AA seqDB search
MDALLNPELRENTQDGSIKVENTAKQVIFKGLAPRVVLSNRLLPKGTKSKVNLEEQGRQK
VSFSFAQTKKPRQNFFFPPPVPEKTQIEGSSAVQSAHLLSTVLGEQSAASKNDPTEKIDV
SAVATIVAVSHLAQPPPPPPPPPPKSKLDLGKMHFKKQILSVVEESPVVSAFSDEPSLGT
AVSISKSPAKIEAQTLVSQLQQKRITSPEKVKREEKAQDKSDAHLKGPVDSSHIGNECKD
QLNVFEPQDNKTDSSLTGSEIDEDCNRKSSSPKSSDSKTAKKSDGHSTDDNKSSSCKTEV
SEKNRSDRREEKEEKGSSRSKTERDSRVDRDSKTERDSRADRDSKTERDSRADRDSKTER
DSRADRDSKTERDSKTERDSKTERDSKTERDSKTERDSRADRDSKTERDSKAERDSRADR
DYKTERDSRAERDSRAERDSRADRDYKTERDSKAERDSRADRDSKTERDSRAERDSKTER
DSRHTSSRSSRSDRRRTRSRSRSRSRSSRTSSSYSRSDRLRNEKQSRSRYHDSERRSHRS
SPYRERRRSRSRADRRSRDSSDSEDDLRKPRTRSSDSSRSSTYSNSQRDSKSSSHSKSYK
DSKSIDSLRPSETDKRVQYSRTERSGRKEKEDIESSKRISPESEASRKKSFHHSKSEINA
NTSTSSSDTSSRSSEKKVQKTCGSSDSDEEHRRKSQSSAPASSSSKTTDTSRSKSSSSPT
GTKRQSVDKENSNKKVLLFDSGTVVSQGELKKVDSSRHEDGTQLKLKRNPPQQNEQTTKK
DNSASKKLALQDTNEDPGSVAVCLTVPEVFKNADVESSRSISKCTVTVKEILEENDQLGK
VTETLVSNELNVLKETENNVPIVSNISSSVNKPSCVGYTPNQDSTGSLADTLSVKELAHE
ACLKPNTTLDSLLDISKEVDRKPSNHDIKTGKGHEQLSIKPERSSAGMLKKGSNSKKSRW
DIVGQDSSEHESPKKMLNPETTPVKDISLKKIHFNSDTNLEEACSEKQDSVVHSVRSDNV
KKPIDCSEESLKKNMHVSAQLLELGTQQTRLVISELVVHTPAKQALDIPPESDCNPESSV
IDLDQKRANHEKLDVDEDSLKPVTQDSASLNCDHKSLSAESETDDSDSDSDDGQSSLKRL
HSVVIVPKNSTITHEPTDQPVPSPSPSSLPGQQQLLCQSYELDKGSNNGILSSHSAQSKL
VEALAEDRNQDVSPSFLQVPYQSQSNMVDSTSQSEVSSALSDANRNCTVYERPKTCFPTS
QEPTHALENAQRDSDLGHHQHYDRPDSWHGRKGEKEQARDLSSSGKFHSRDGCNMGWGSQ
PEQPSSTFQQPDSSHSTKQPPQIGSAFIRQDRDGWTHNSRPVGMSLTSRCHDMVGQIHPD
SLTNDNDEDYEAKALAISRGIVPSSEFETFVQAHEISSNCSFVNASSESPIVLEPPREDS
QKPHRGRGPPKKRRPELESESDNEADAGLACKKECLEERDSCKSLSETKASLDQESAQRP
LLSLKEFTDPGVWREKARQKKMPPYFDLIEENIYLTERKKNKSHRDIKRMQCECAILSRE
ERGRGMMACGEDCLNRLLMIECSSRCLNGMYCSNRRFQMKQHADFEVILTESKGWGLRAA
KDLPANTFVLEYCGEVLDHKEFKSRVKEYARNKNIHYYFMALKNNEIIDATLKGNCSRFM
NHSCEPNCETQKWTVNGQLRVGFFTTKAVSAGTELTFDYQFQRYGKEAQKCFCGAPSCRG
FLGGENRVSVRAAVGKKQKERSRKKETVSALTTVDEELEALLENGEGLSDEKEVISLCRL
MVRVETTEQRFTCIKLLRNTQNHSCLKQFLDHHGLSLLWIFMADVSETKSNSANNFKLQF
EIMKALAVLPISTKNMLEESRVLQFIQRWAKSHPLGHPPEQDGYSSESTSRAQTPLNTPD
GPPAKLAPELDGDTPKRAVYRRLKIISENSLDSALSDGSKASDGKEEDEEEEEEIEEESS
QMEVQTDAAEMKESGAESQVEAESQSLVKHEVSDVAESSQPKAEEEEEGANEDGPEGEEL
DIKEKVAVEKEESQSVQVEEKPEADPEPVTEPEPQPQPQPQSQPEPEPEPELISQVEAPV
VEQPSDPTSIQAEEDPSMSVEASGDNEEPTVATETAVENTSCGPSDIIVSGQSNTHVSLE
ASEVMIETAPASDATTVIITTETQPAALNLEDVPPSSSVTSSAEGKTVSLEGADVAPGDI
TPADVAPAAVPEIPSSVVAAEGAVMVAEGAVVGTPSQDEEEAVSDVESERSQEPQIRAVD
ISEMAARLLDSWKDLKEVYRIPKKSQVEKELNERSRDREVMLTPRTPSSSSRERERERER
ERDRERDRERERERDWEREWERERERDSERAMMRSAERRRRRGSASPPPSSSYERSSRRN
DDRYDQSSSSKKKSRIKLSTEERRKLFEQEVAQREAQKQQQQQQQQQQQQQEQQQQQLQR
LAFDPLLYASSGFMTYPPGYPIQTYVDPSNPNAGKVLLPTPAVEPMCGAPAGTVPAVSFE
QAASQPLITELGMTSPTASTTQDGAASSLAHVPTQTQQFVQPTVPAQDPGVAVLSVPAQA
ASPQVQGQQGYATLWDPSTQQAVTVQTQPAQQYSTTAQPQTAIYYQGQPCQAIYSIPAGY
PQTNTPVIQTYTEPTTGYLHGQQVYTGHPQGVVVQQGGTVTTIVTSQTVQQEMIVPNSIM
DLPPPSPPKPKTIILPPTWKVARDPEGKIYYYHVVTRQTQWDPPTWDGVGEEASVEHEAE
MDLGTPTYDENPSKFSTKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKLGR
ISNTEDFKHLARKLTHGVMNKELKSCKNPEDLECNENVKHKTKEYIKKYMQKFGTVYRPK
EDTELD
NT seq 8661 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttgctgaatcccgagctcagggaaaacacacaagatggctcgatcaaagtg
gagaacactgcaaagcaagtcatatttaaaggccttgcccccagggtggtcttgtcgaac
cgtctcctgcccaaaggaacaaagtctaaggtgaacctagaagagcagggtcgacagaag
gtgtctttcagtttcgcacaaaccaagaagcctcgccagaacttcttctttcccccgcct
gtcccagagaaaacccagattgaaggttcttctgcagtgcagtctgcacacctgctctcc
acagtcctaggagagcaaagtgctgcaagcaagaatgatccaactgagaagattgacgtc
tctgctgtggccacaatagtggcagtgtcccatttggcacaacccccgcctcccccacct
cccccaccgcccaaatcaaagcttgaccttggcaagatgcattttaaaaagcaaattctt
tcagtcgttgaggaaagtcctgttgtcagcgctttttcagatgaacccagcttaggtaca
gcagtttcaataagcaaatctccagcaaagattgaagcccaaacattggtgtctcagctc
cagcagaaaagaatcacttctcctgaaaaagttaagagggaggaaaaagctcaggacaaa
tcggatgctcacctcaaaggaccagtggattcttcccatattgggaacgagtgtaaggat
cagctcaatgtttttgaacctcaagacaacaaaacggacagctctctgaccggttctgag
attgatgaggattgcaataggaaatcttccagcccaaagtctagtgactccaagactgca
aaaaaatctgatggtcacagtacagatgacaacaaatcatccagttgtaaaacagaggtg
tcagagaaaaatagatctgataggagagaagagaaagaggaaaaggggtcaagccgttcc
aaaacagagcgagactccagagtggaccgggactccaaaacagagcgagactccagagcg
gatcgggactccaaaacagagcgggactccagagcggacagggactccaaaacagagcgg
gactccagagcggacagggactccaaaacagagcgggactccaaaactgagagggactcc
aaaactgagagggactcaaaaacagagcgggactccaaaactgagagggactccagagcg
gacagggactccaaaactgagagggactctaaagctgagagagactccagagcagatagg
gactacaaaactgagagggactctagagcggagagggactctagagctgagagagactct
agagcagacagggactacaaaactgagagggactctaaagctgagagagactccagagca
gatagggactccaaaacagagagggactctagagctgagagggactccaaaacagaaaga
gactctagacatacatcatcacggtcttctcgatctgacaggaggaggaccaggagtcgc
tcccggtctagatcccgaagttctcgaactagctcttcctactccagatcagacagattg
agaaatgagaaacagtccaggtcacgttatcacgattctgaaagaaggtcccatcgaagt
tctccttatcgtgagcggagacgatcccgctctagagctgacaggcgatctcgggacagc
tcagactctgaggacgacctcaggaaaccgaggacgcgaagcagcgactcgagccggtcc
tcgacctactcaaattcacagagggattccaagtcatcctctcactcaaagtcctacaaa
gactcaaaatccatagattccttacgcccatcagaaacagacaagagagtacagtactca
agaacagaaagatctggaagaaaagaaaaggaagacatcgaaagcagtaagagaatctcc
cccgagtctgaagccagtcgtaaaaaatcttttcaccattcaaaatctgagataaacgct
aatacgtcaacttccagctcagatacatcatcaaggtcttctgagaaaaaggtccagaaa
acttgtgggagctctgattcagatgaggagcaccgcagaaagtctcagtcttctgcgcct
gctagttcatcttctaaaacaacagatacttcaagatccaaatcttcatctagtccaact
ggaactaaaagacaatcagtagacaaagaaaatagtaataagaaggtgctactttttgat
tctggcacagttgtgtctcagggagaattgaaaaaagtggacagttctcgacatgaagat
ggtactcagttaaaattaaagaggaatcctcctcaacagaatgagcaaactacaaaaaag
gacaactcagcaagcaagaagcttgctttacaagatacaaacgaggatcctggttctgtg
gcagtgtgcctgactgtgcctgaagttttcaaaaatgctgatgtggaatcaagtcgtagc
ataagtaaatgtactgtaacggtcaaagaaatcctagaagaaaatgatcagcttgggaag
gtaacggagactctagtcagcaatgaacttaatgttttaaaagaaactgagaataatgta
ccgattgtcagtaatatttcttccagcgtaaataagccgtcttgcgtgggttatactccc
aatcaggattccacaggatcgttggcagacactctttctgtgaaagaattagcgcatgaa
gcatgcttgaaacctaacactacacttgattctctgttggatattagtaaagaagtcgat
aggaagcccagtaatcacgatatcaagactggcaaaggacatgagcagcttagtataaaa
ccggaacggtccagtgctggcatgttaaagaagggtagtaattcaaaaaaatcacgttgg
gatattgttggacaagacagttccgaacacgagagccccaaaaagatgttgaacccagaa
actacacctgtaaaggatatctctttaaagaaaatacattttaatagtgatacgaacctc
gaagaggcctgctcagaaaaacaagactctgtagtacattctgtgaggtcagataatgta
aaaaagccaatagattgttcagaggaatccctgaaaaaaaatatgcatgtttctgcccag
ttacttgaacttggtacccaacaaactaggcttgtaatcagtgagcttgttgtccacacc
ccagcaaaacaagctctggacattcctcctgaatcagactgcaatcctgaatcaagtgtt
attgatttggatcagaaacgtgctaatcatgaaaagttggatgtcgatgaagactctctt
aagcctgttactcaggactctgcatcccttaattgtgatcataaaagccttagcgcagaa
agtgagacggatgactctgactctgattccgatgacggacagagctctttgaagcgactg
cactctgtggtgattgtgccaaagaattctaccattacccatgagccgactgaccagcct
gtaccgtctccaagtccgtcctctctccccggacagcagcagctactgtgtcaatcttat
gagttggataagggcagtaacaatgggattcttagtagtcatagcgctcagtctaagctt
gtggaagctttggccgaagatagaaaccaggacgtctcaccttcttttctgcaagtgccc
taccagtcccagagcaacatggttgacagcactagccagtctgaggtaagcagtgctctt
tcagatgcgaacaggaactgcactgtctatgaaagaccaaagacttgttttccaacaagc
caagaacctacacatgctcttgaaaatgcacaacgggattctgacttgggtcatcatcag
cactatgatagaccagacagctggcatgggagaaaaggagaaaaagaacaggccagggac
ctcagttcctcaggcaaatttcatagtagggatggttgtaacatgggttgggggtctcag
ccagagcaacctagcagcacgtttcagcaaccggacagcagccacagtaccaagcagccc
ccccagatagggagtgcatttatcaggcaagaccgtgatggttggacgcataatagcaga
cctgtcggcatgtctttgacttctcgctgtcatgatatggtgggtcagattcacccggac
tcgctgaccaacgacaatgatgaagactacgaggcaaaagcgctagctatcagtcgaggg
attgtaccatcttcggaatttgaaacgtttgtccaagctcacgagatcagcagcaactgc
agctttgtgaatgcttcttccgagagcccgattgttctggagcctcccagagaagacagc
cagaagcctcacagaggcagaggcccgcccaaaaagaggcgtcctgaattggagtctgaa
tcggacaatgaggcggatgcagggcttgcttgcaagaaggaatgcttggaggagcgcgac
tcctgcaaaagcttgagtgaaaccaaggcatccttggatcaggaaagcgcacagcggccg
ctgctcagcctgaaggagtttacagacccgggtgtctggagggaaaaagccaggcagaaa
aagatgcctccgtattttgacctcattgaagagaatatttacttgacagaacgcaagaag
aataagtctcatcgggacattaagcgaatgcagtgcgagtgtgccatcctttcaagagag
gagcgaggaagagggatgatggcttgtggagaagattgcttaaatcgtcttctgatgatc
gagtgctcgtcccgctgcttaaacggaatgtattgctccaatcgtcgcttccagatgaag
caacatgcagactttgaagtcattctaacagaaagcaaaggctggggtttgcgggcagcc
aaagacctcccggcgaacacctttgtgctggagtactgcggcgaggttctggatcacaag
gagtttaagtcccgggtgaaggagtacgctcgcaacaagaacatccactactacttcatg
gccctgaagaacaacgagatcatcgatgcaactctgaaaggcaactgctcgcgtttcatg
aaccacagctgtgagcccaactgtgaaacccagaagtggacagtgaatggtcagctccgg
gttggcttctttaccaccaaagctgtgagcgctggcactgagctcactttcgattaccag
tttcagagatatgggaaagaggctcagaagtgtttctgtggagctccaagctgtcgcggg
ttcctcggtggagagaaccgtgttagcgtgcgagcagctgtgggaaagaaacagaaagag
cgatctcgcaagaaagaaaccgtcagtgctcttactacggtggatgaggagctggaggct
ctgctggagaacggtgaaggtctgagtgatgagaaggaagtgatttctctctgcaggctg
atggtgcgagtggagaccacggagcagagatttacctgcattaaactcctccggaatacc
cagaaccattcgtgcctgaagcagttcttggatcatcatggtctctcgttgctctggatt
ttcatggctgacgtttcggagacaaaaagcaactctgccaacaacttcaaactgcagttt
gagataatgaaggctttggcggtgctgcccatctccactaagaacatgttggaggagagt
cgtgtgctgcagttcatccagcgctgggccaagagccacccactcggacatcctccggag
caggacggctactccagcgagagcacgtcccgcgcccagacacctttaaacacacccgac
ggccctccggctaaactggccccggagctggacggagacacgccgaaacgcgccgtctac
cgccgtctgaagatcatcagcgagaacagtctggacagcgcgctctcggatggcagcaaa
gcctctgacggcaaggaggaagatgaggaagaggaggaagagatagaggaggagtcttcc
cagatggaggtccaaacagatgcagcagaaatgaaggagagcggcgctgagagtcaggtt
gaagcagagtctcagtcactggtgaagcatgaagtttctgacgtcgctgagagtagccag
cctaaggctgaggaggaggaagaaggtgctaatgaagacggacctgagggagaggagctg
gacattaaggagaaggtggctgtcgagaaagaggagagtcagtctgttcaggttgaggag
aagcctgaagcagaccctgagcctgtgacggaacctgagcctcaaccccaacctcaacct
cagtctcaacctgagcctgagcctgagcctgagctgatcagccaggtagaagcacctgtt
gtggagcagccttctgatccgaccagcatccaagctgaagaagaccctagcatgtctgtg
gaagcctctggtgataatgaagaaccaactgtcgccacagaaactgctgttgaaaacacg
tcttgcggtccttcagacattattgttagtggtcagtccaacactcatgtctccttggaa
gcttctgaagttatgatcgaaacagcgcctgcttctgacgctacgaccgtcatcatcacc
accgaaacccaaccagcagctctgaacctggaggatgttccacccagttcctcagtgacc
tcctctgcagagggtaaaactgtctctttggaaggtgctgacgtcgctccaggtgatatc
actccagctgacgttgctcctgctgctgtgccagagattccatcctcagttgtggcggca
gaaggtgcagtgatggtggctgaaggtgctgttgtgggcaccccatcccaagacgaggag
gaggcagtatctgacgtggaaagcgagaggagccaagagccacagatcagagcagttgac
atcagtgaaatggcagcacgcctccttgacagctggaaagacctgaaggaggtgtatcgg
atccctaaaaagagtcaggtggagaaagagttaaacgagcgcagcagggaccgtgaagtg
atgctgacgcctcgaacaccctcctccagcagccgtgagcgcgagagagagcgggaacgc
gagagggaccgagagcgtgatcgagagcgagagagggagcgagactgggagagagagtgg
gaaagggagcgagagagggactctgaaagagccatgatgcgcagcgctgagaggcggagg
aggcgggggtctgcttcgcctccgccttcgtcgtcttacgagagaagcagtcgcagaaat
gacgaccgatatgaccagtccagcagcagtaagaaaaagtcccgtattaagctgtccact
gaggagcgcaggaagctgtttgagcaggaagtggctcagagagaagctcagaaacagcag
cagcagcagcaacaacagcagcagcagcaacaggagcaacaacagcagcagcttcagagg
ctagcgttcgacccactattgtacgcttccagtggatttatgacctaccctccgggttac
cccatccagacttatgtggacccttccaaccccaacgcgggcaaggtcctgctgcccacc
ccggccgtggagccaatgtgcggggctccggccggcactgtccccgccgtctccttcgaa
caggctgcctcccagccgctcatcactgaactcggcatgacctccccgacagccagcacc
acccaggacggcgcggcctccagcctggcgcacgtgcccacacagacacagcaattcgtc
cagcccactgtgccagcgcaggaccccggggtggccgtcctgtctgtgccggcccaggcg
gccagtccgcaggtgcagggtcagcagggatacgccactctgtgggaccccagcactcag
caggccgtcactgtgcagacacagcctgcgcagcagtattccaccaccgcgcagccacag
accgctatctactaccagggccagccatgccaggccatctacagcattccagcagggtac
ccgcagaccaacactccagtcatacagacctacaccgagccgaccaccggatacctgcat
ggccagcaggtctacaccggtcacccgcagggagtggtggtccagcagggtggcaccgtc
accaccatagtcacttctcagaccgtacagcaggagatgattgtacccaacagcatcatg
gacctgcctccaccttcacctcccaaacccaaaaccatcatcctgcctccaacttggaaa
gtagcgcgagatcctgaaggaaagatctattactaccatgtagtcaccaggcaaacgcag
tgggatccgcctacctgggacggcgttggggaagaggccagtgtggagcacgaggctgag
atggatttgggaacaccaacgtacgacgaaaacccctcaaagttctccactaagacagca
gaggcagacacgtccagtgagctcgcaaagaaaagtaaagaagtcttccgcaaggagatg
tcgcagttcatagtgcaatgccttaatccctatcgaaagcctgactgcaaactgggccgc
atcagcaacaccgaggacttcaaacatctcgccaggaagctaactcatggagtgatgaac
aaggaactgaagtcctgcaagaacccagaggacctggagtgcaatgagaacgttaaacac
aagaccaaggagtacattaagaagtacatgcagaaattcggcactgtgtatcgtcctaaa
gaggacacagagctggactag

DBGET integrated database retrieval system