KEGG   Astyanax mexicanus (Mexican tetra): 103040418Help
Entry
103040418         CDS       T05042                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amex01002]
    103040418 (tmprss2)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103040418 (tmprss2)
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103040418 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR SRCR Trypsin_2 DUF1986 TgMIC1 DUF3149
Motif
Other DBs
NCBI-GeneID: 103040418
NCBI-ProteinID: XP_022536726
Ensembl: ENSAMXG00000006413 ENSAMXG00000006414
LinkDB All DBs
Position
20
AA seq 470 aa AA seqDB search
MYSNTSHDNYGFQHEDERPPPYHPPPYAPNYSQGLYPTLPQYPTTPHVPINTHHTVTAGQ
PHPTATRKVAGRNQWFCIVPAIITILVVVGVAAVLVWYFAFQMCGTGQRCGENGLRDCSG
GECFRLYGSNFQLLSFSAKDKTWKPVCSSRWDDNIGRRACQQMGYSRTDYVSSGEMKPGS
GSSGGYMVLNTDYISGISSAESAHSYLTDSSTCQSNAVVTLKCVECGKSTVQTRIVGGEV
VTSRTRWPWQVSLQSGGGHLCGGSIISSSWIVSAAHCFQSRPHPSQWTVFAGFLTRNEMR
SSPGNSVSHIISHAGYDSRTNDNDIALMKLSTPLRLSSSVGPVCLPSAGLDFSAPRECYI
TGFGALFSQGPASNELREAKVTLINRSICNSRVVYNGQITDTMICAGKLEGGVDACQGDS
GGPLVTQENSLWYLVGDTSWGQGCAVRNKPGVYGNVTFFLGWISEQMQKY
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtaacacgtcacatgataactacgggtttcagcatgaggatgagcgccctccg
ccctatcaccctcccccatacgcccccaactattcccagggcctttaccccaccctccca
cagtaccccaccaccccacacgtacccatcaacacccaccacaccgtcaccgccggccaa
ccccatcctactgcaacccgcaaagtggctgggaggaatcaatggttctgcatagtgccc
gccatcatcaccatcttagtggttgtgggagtagcagctgtactggtctggtacttcgcc
ttccagatgtgtggcacgggccagaggtgtggggagaatggactgagggactgttcggga
ggagagtgctttcgactatatggatcaaatttccagctgctgagcttctcagcaaaagac
aaaacatggaagccggtgtgttcgtccagatgggacgacaacattgggaggagagcatgc
cagcagatgggatacagcaggaccgactatgtaagttctggggagatgaagccaggctcc
ggttcctcgggcggctacatggttctgaacactgactacattagcgggatcagttctgca
gagtctgcacacagttacctcactgacagttctacctgccagtctaacgcagtggtcacg
ctgaagtgtgttgagtgtggtaaatccacagttcagacgcggatagtcggcggggaagtt
gtgaccagtagaacccgttggccctggcaggtcagcctgcagtctggcggggggcacctg
tgtggagggtccatcatcagctcgtcctggatcgtctccgctgctcactgctttcaatca
cgtccgcatccaagtcagtggactgtgtttgcgggatttctcacacggaatgagatgcgg
tccagtcctggaaactcagtcagccatatcatctcccacgctggctatgattcccgaact
aatgataacgatattgctctgatgaaactttcaacaccactccgcttatcatctagtgtt
ggaccagtttgtttacccagtgccggccttgacttctctgctccaagggaatgttatatc
actggatttggagctcttttcagccaaggtcctgcctcaaatgagttacgggaggccaaa
gtgacactgataaacaggtccatctgcaacagccgcgtggtctacaacggacaaatcaca
gacaccatgatctgcgcaggaaagctggagggtggagtggatgcctgtcagggggacagt
gggggtcctctggtcacacaggagaattcactatggtatctggttggggataccagctgg
ggtcagggatgtgctgttagaaacaagcctggtgtttatggaaatgttaccttcttcctt
ggatggatttccgagcaaatgcagaaatattaa

DBGET integrated database retrieval system