KEGG   Astyanax mexicanus (Mexican tetra): 103040657Help
Entry
103040657         CDS       T05042                                 

Gene name
pnpla7
Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103040657 (pnpla7)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     103040657 (pnpla7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Patatin
Motif
Other DBs
NCBI-GeneID: 103040657
NCBI-ProteinID: XP_022523341
LinkDB All DBs
Position
Unknown
AA seq 1369 aa AA seqDB search
MGVNVLIEADKFAVDKRRRGIREQIKMGDKEEEDSCSIYPTPMQYGQEFRARVQAFMEDQ
LHTTMWTGVLIGVAAAVSLISVVVFFLYRRYKAKEHQTPQYRFRKRDKVMFYGRKIMRKV
QTLSSPVSSGPVSQKRTRKRPKVLSIARKFLRIRREPPTLQPKEPPPSVLEADLTEFDVQ
NSNLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFVELQQGEGLFRPGDIDDSIFVVQDG
RLDLCIHESDGTELVVKHVQAGDSVHSLLSILDIITGYPAPYKTVSARAAAPTTVLRLPA
KAFQSVFEKYPETLVRVIQIIMVRLQRVTFLALHNYLGLTTELFNPESQAIPLESVASVL
GEGGPGRSHRRFSQSEIHTADKPAHHSVERHTDTDSAKSSPTQSPSASFRKSRSMSTPTD
SSISAGSGDLNTAFERVNKNETHSHPVVYKSILKKTVTMQHTPSAVYHYSDTGGHSGHVH
HSKINAIFQAAKKDLLKIIQLQDPSLLEGRVTLRQVKAGCVVASQGDQEVSMQFVVSGAL
HVYQRMIDRDEDLCLFVTHPGELVGHLAVLTGEPLIFSVRAHRDCSFLSISKTHFYEIMR
AEPRVVLNVAHTVVRRVSPFVRQIDFALDWMAVEAGRAVYRQGDKSDSTFIVLSGRLRSV
IMREDGKKELAGEYGRGDLIGVVEALTHMNRATTVHAVRDSELAKMPEGALNSIKRNTPQ
VVTRLIHLLGQKILGNMQQVNGPLSVHGLGLHTPGSKWDAGNPASNLATVSILPVSDEVP
MTAFTLELQHALSAIGPTLLLTSDIIKQRLGAAALDSVHEYRLSSWLGQQEDIHRIVLYQ
SDSTLTPWTQRCIRQADCILIVGLGEQEPTVGELERMLEGSAVRAQKQLVLLHREDGPPP
SGTAEWLNMRSWISRHLHLSCPRRVFSRRSLPKLREMYQRVFEKPPDRHSDFSRLARVLT
GNAIALVLGGGGARGCSQVGIIRALCEAGIPVDLVGGTSVGSLMAALFADERSYSHMKVR
AREWAMDFSSIFKRILDLTYPVTSMFTGASFNSSIGGVFKGKQIEDLWLPYFNITTDITA
SSMRVHTDGSLWRYVRASMSLSGYLPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVI
AIDVGSQDETNLTNYGDSLSGWWLLWKRLNPLAERVKVLNMAEIQTRLAYVCCVRQLESV
KDSDYCEYIRPSIDRFGTLDFGKFDEIADVGYQHGKTVFDVWCRSGVVEKMLKDRHQEEF
HRSKGNNVVTCPNASFTDLAEIVSRIEPVKQAIVDEESEYQTDYDEDVVLSDFELSNASS
DHEEHTEEEEEEHTEEEETGDTADTDEEIKMTRQRRRNHKTNHARHSNH
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaatgtgttgattgaagcggacaagtttgcagtggacaaaaggaggaggggg
atcagggaacaaatcaaaatgggcgacaaagaagaagaggacagctgcagtatttatcca
acaccgatgcagtatggacaagaattcagggcccgagttcaggcctttatggaggaccag
ctgcacaccactatgtggacgggtgtgctgattggagtagcagctgctgtctccctcatt
agtgttgtcgtattttttctgtacagaagatataaagcaaaagaacatcaaaccccccag
tatcgcttcagaaaacgagataaagtgatgttttatggaagaaaaataatgagaaaggtg
cagaccttatcctccccggtcagttcaggtccagtgtctcaaaagcgaaccagaaagaga
cccaaagttctctcaatagcgcgcaagttcctgcggattcgccgagaaccgcccaccctc
cagcccaaggagccacctccttccgttctggaggccgacctgactgagtttgacgtgcag
aactcaaacctgccgtcagaagttctgtacatgctgaagaatgtcagggtgctgggtcac
tttgagaagcctctgtttctggaactgtgtcgccacatggtgtttgtggagctgcagcag
ggggagggtctatttcgccccggagacattgacgacagcatcttcgtggtgcaggacggc
cggctggacctgtgcattcatgagagcgatggaactgaactggtggtaaagcatgtgcag
gctggagacagtgttcacagtttgctcagtattctggacatcatcacgggatatccagct
ccctataaaactgtatcagccagagctgcagctccaaccacggttctccgccttccagct
aaagccttccaatcagtgtttgagaaatatccagaaactctggtccgcgtcattcagatc
atcatggtgcgtctgcagagagtgaccttcctcgccctgcacaactacctgggactgacc
actgagctcttcaatccggagagtcaggcgattcctttggagtccgtggccagtgttttg
ggggagggtggtccaggccgaagtcaccgcaggttctctcagtcagagatacatacggct
gataaacctgctcatcacagtgtggagagacacaccgacacagacagtgcaaaatccagc
ccaacacagagcccctcagcctccttcaggaagtcccgctccatgtccactccaacagac
agctccatttcagcagggtcaggtgaccttaacacagcctttgaacgagtgaacaaaaat
gaaactcattcacacccggttgtttacaagtcaatcctgaagaagaccgtgaccatgcag
cacactccctctgcggtctaccactattcggacactggagggcactccggccacgttcac
cacagcaaaatcaatgccatctttcaggctgccaagaaagacctgcttaaaatcattcag
ctgcaggaccccagtcttctggagggcagagttaccctgaggcaggtgaaggctggctgt
gtggtggcaagccaaggagaccaggaagtcagcatgcagtttgttgtctcgggcgctctg
catgtgtaccagcggatgattgacagggatgaggacctgtgtctgtttgtgactcacccg
ggagagctggtgggacacctggcagtgctaacgggcgaaccgctaatcttcagtgttcga
gctcaccgtgactgcagcttcctgtccatctccaaaacacacttttatgagatcatgcgt
gctgagccccgcgtggtgctgaatgtggctcacactgtggtgcgcagagtctcgcccttc
gtcagacagatcgacttcgctctcgactggatggcagtggaggctggaagagccgtctac
aggcagggtgataaatcggacagtacctttattgtgctgagtgggcgtctgcgctcggtc
atcatgagggaggatgggaagaaggagctggctggagagtacggacggggtgatctcatc
ggggtggttgaagctctgacccacatgaaccgggccaccacagttcacgccgtccgagac
tctgagctcgccaagatgcctgagggagccctgaactccatcaaacgaaatacccctcag
gttgtgacgaggctgattcacctgcttggacagaagatcctgggaaacatgcagcaagtt
aatggacctttatcagtccacggcctgggcttgcacacccctgggagtaaatgggatgca
ggtaaccccgcctcaaacctggccaccgtctccatcctgccagtatcagatgaggtaccg
atgaccgccttcaccctggagctgcagcacgctctcagtgctatcggtcctactttactc
ctgaccagcgacatcattaaacagcgcctgggcgccgcagcactggacagtgttcatgag
tatcggctgtccagttggctgggtcagcaggaggatatccaccggattgttctgtaccag
tctgacagcactctgaccccctggacccagcgctgtatccgccaagccgactgcatcctt
attgtggggctcggagagcaggaacccactgtgggagagctggagcggatgctggagggc
agtgcggtgagggctcagaagcagctggtgctcctgcaccgtgaggacggtcccccaccc
agcggaacggccgagtggctcaacatgcgcagctggatctccagacacctgcacctgtcc
tgtccccgccgggtcttcagccgcaggagtcttcccaaactgagagagatgtatcagcgt
gtttttgagaagcctccggaccgtcactcggatttctcccgcctggcccgcgtgctgacg
ggcaatgccatagcgctggtactggggggtggaggtgccaggggctgttctcaggtgggc
atcattcgcgctctgtgtgaagcgggcatccctgtggatctggtgggcggcacttccgtc
ggctccctgatggcggcgctgtttgctgacgagaggagctacagtcacatgaaagtcagg
gcgcgagagtgggccatggacttcagctccattttcaagcggatcctggacctgacgtac
ccggtcacctccatgttcacaggagcttccttcaactccagcattggtggcgttttcaag
ggcaaacagattgaggacctctggcttccttattttaacatcaccacagacatcactgcc
tcctccatgagagtacacactgatggttctctgtggaggtacgttcgtgccagcatgtct
ctctcaggctacttgcctcccctctgtgatccaaaagatgggcatttactcatggacggt
ggatacatcaacaacctgcctgctgacgtcgctcgctcgatgggcgccaaggtggtgatt
gccattgacgtgggcagccaggacgagaccaacctcaccaactacggggactctctgtcc
gggtggtggctgctgtggaagcgtctgaatcctctggcagagagagtgaaggtcctgaac
atggcggagatccagacccggctggcatacgtgtgctgcgttcgtcagctcgagtcggtc
aaggacagcgactactgcgagtacatccggccctccatcgatcgctttggcacgctggac
tttggcaagtttgatgaaatcgctgatgtgggctatcaacatggaaagacggtgtttgat
gtatggtgccgcagcggcgtggtggagaaaatgctgaaagatcgacaccaagaggagttc
cacaggagcaagggcaacaatgtggtgacctgtcccaacgcctcctttacggacctggcc
gagatagtgtcccggatagaaccggtgaagcaggccatcgtggacgaggagtccgagtac
cagacggactacgacgaggacgtggtgctgtcagacttcgagctgtccaacgccagcagt
gaccatgaggagcacactgaggaggaagaggaggagcatacggaagaggaggagacggga
gacactgcagatacagatgaagaaatcaagatgacaagacaacgaagacgaaaccataaa
accaaccatgcgagacacagcaatcactga

DBGET integrated database retrieval system