KEGG   Astyanax mexicanus (Mexican tetra): 103040659Help
Entry
103040659         CDS       T05042                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04012  ErbB signaling pathway
amex04068  FoxO signaling pathway
amex04140  Autophagy - animal
amex04150  mTOR signaling pathway
amex04210  Apoptosis
amex04218  Cellular senescence
amex04261  Adrenergic signaling in cardiomyocytes
amex04370  VEGF signaling pathway
amex04371  Apelin signaling pathway
amex04510  Focal adhesion
amex04620  Toll-like receptor signaling pathway
amex04625  C-type lectin receptor signaling pathway
amex04910  Insulin signaling pathway
amex04914  Progesterone-mediated oocyte maturation
amex04920  Adipocytokine signaling pathway
amex04933  AGE-RAGE signaling pathway in diabetic complications
amex05132  Salmonella infection
amex05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103040659 (akt1)
   04012 ErbB signaling pathway
    103040659 (akt1)
   04370 VEGF signaling pathway
    103040659 (akt1)
   04371 Apelin signaling pathway
    103040659 (akt1)
   04068 FoxO signaling pathway
    103040659 (akt1)
   04150 mTOR signaling pathway
    103040659 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103040659 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    103040659 (akt1)
   04218 Cellular senescence
    103040659 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103040659 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103040659 (akt1)
   04625 C-type lectin receptor signaling pathway
    103040659 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103040659 (akt1)
   04920 Adipocytokine signaling pathway
    103040659 (akt1)
   04914 Progesterone-mediated oocyte maturation
    103040659 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103040659 (akt1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103040659 (akt1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103040659 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103040659 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103040659 (akt1)
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103040659 (akt1)
Protein kinases [BR:amex01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103040659 (akt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH FTA2
Motif
Other DBs
NCBI-GeneID: 103040659
NCBI-ProteinID: XP_022528304
LinkDB All DBs
Position
9
AA seq 473 aa AA seqDB search
MTDVVIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPSTFIIRCLQWTTVIERTFHVETPEEREEWIKAIQAVADSLQKQEEEMMDS
SPDPMDMEMYLTKPRHKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
DRARFYGAEIVSALDYLHSERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDIR
FPRTLAPEGKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKKLIAPFKP
QVTSETDTRYFDEEFTAQTITITPPGEDESMEPFDSERRPHFPKFSYSASGTC
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtggtgatcgtgaaggaagggtggctccacaaacgaggagagtacattaag
acgtggaggccgaggtatttcctgctgaagaatgacggtacgtttattgggtataaggag
agaccacaagatgtggaccagctggagactcccctcaataacttctctgtggcacagtgt
cagctgatgaagacggagcggcccaagcccagcacatttatcatccgctgcctgcagtgg
accactgtcattgagcgcaccttccatgtggagaccccagaggaacgggaggagtggatc
aaagccatccaggctgtggcggacagtctgcagaaacaagaggaggagatgatggactcc
tctcctgaccccatggacatggagatgtatctgaccaaacctcgacacaaagtgactatg
catgactttgaatacctcaaactccttgggaaaggcacttttggcaaagtcatcctggtg
aaggagaaggccacagggaaatactacgccatgaaaatccttaagaaggaagtcatagta
gcaaaagatgaagtggctcacacactcactgaaaaccgtgtgctccagaattctaaacac
cccttcttgacggggctgaaatactccttccaaacacatgatcgtctctgcttcgtcatg
gagtatgcaaacggaggagagcttttctttcacttgtcgcgggaccgggtgttctccgag
gatcgggcgcggttctatggtgctgaaatagtgtctgcgctggactacctgcactctgag
aggaacgtggtgtaccgggatctgaagttggaaaatctgatgctggacaaagatggccac
ataaagatcacagactttgggctttgtaaggagggcataaaggacggggccaccatgaag
accttctgtggaactccagagtatctggctcctgaggtactagaggataacgattacggc
cgtgctgtagactggtgggggctgggcgtggtgatgtatgagatgatgtgtggacgcctt
cctttctacaaccaggatcacgagcgtctattcgagctcattctcatggaggacatccgt
ttcccccggactctcgctcccgagggcaagtctctcctctccgggctcctcaagaaagac
cctaaacaacggttaggaggcggtccagatgatgcgaaggaaatcatgcagcacaagttt
tttgctggaattgtgtggcaagatgtttacgagaaaaagctgattgctccatttaagccc
caggttacctcagaaacggacacaaggtattttgatgaggagttcactgcacagaccatc
accatcacaccacctggagaagatgaaagcatggagccgtttgacagcgagaggagaccc
cacttccctaagttttcttactcagccagcgggacctgctag

DBGET integrated database retrieval system