KEGG   Astyanax mexicanus (Mexican tetra): 103040846Help
Entry
103040846         CDS       T05042                                 

Gene name
ercc1
Definition
(RefSeq) DNA excision repair protein ERCC-1 isoform X2
  KO
K10849  DNA excision repair protein ERCC-1
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex03420  Nucleotide excision repair
amex03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    103040846 (ercc1)
   03460 Fanconi anemia pathway
    103040846 (ercc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amex03400]
    103040846 (ercc1)
DNA repair and recombination proteins [BR:amex03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     103040846 (ercc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad10 HHH_5 HHH HHH_2
Motif
Other DBs
NCBI-GeneID: 103040846
NCBI-ProteinID: XP_007227818
Ensembl: ENSAMXG00000002160
LinkDB All DBs
Position
19
AA seq 361 aa AA seqDB search
MENKKFKINLDDSAFNKERNPVTSLFKPSSKGVQGETSSAQTAPQTTGQPLSYAEFIVQS
RSRGAQTAAPGLETQDGCRDLGSSRESVTKPSAHPGKPPAGRSEKEVSEPPAASVTPAAA
PDPTVVSERQEEDLSEEKRKEEGQNAQLTVTPHQLGSGNSIIVSPRQRGNPILKFVRSVP
WEFAEVVPDYVLGRTTCALFLSLRYHNLNPNYIHERLKQLGQTFTLRVLLVQVDVKDPHH
ALKELARICIMADCTLILAWSPEEAGRYLETYKSYEKKPADLLKEQVEKDYLSKVTDCLT
TVKSVNKTDAITLLSAFSSLEGIINASKEELVLCPGLGPQKAKRLHDVLHQPFLKSKKKD
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaagaaatttaagattaacctggacgattctgcttttaacaaagagagaaac
ccggttacttctcttttcaagccctcatctaaaggagttcaaggcgagacctcgtctgca
cagactgcaccacaaaccactggccagcctttatcatacgcagagtttattgtccagagc
aggagcagaggtgcccagacagctgcccctggactagagactcaggatgggtgcagagat
ttgggttccagccgtgaatcagttactaaaccatcagcacatcctggaaaacctccagct
ggaagaagtgagaaggaggtttcagaaccaccagcagcatcagtgacaccagcagcagca
ccagaccccactgtagtttcagagaggcaggaggaggatttatctgaagagaagagaaag
gaagaaggtcaaaatgcacagcttactgttaccccacatcagctggggtcaggaaacagc
attatcgtcagcccacgacagagaggaaaccctatcctgaagtttgtcaggagtgttcca
tgggagtttgcagaagtggtgcctgactatgttttggggcgaacaacatgtgcactcttt
ctcagtctgcggtatcacaacctgaacccaaactacatccatgagcggctgaagcagttg
ggacagaccttcacccttcgagtgctgctcgtgcaggtcgacgtgaaagacccccatcat
gctctgaaggaactggctcgtatctgcatcatggctgactgcacgctcatcttggcctgg
agccctgaggaagctggtcgttacttggagacgtataaatcctatgagaagaagcctgca
gatcttcttaaagagcaagtagagaaagattacctctctaaggttacagattgcttgact
acagtgaaatctgttaataaaaccgatgccatcacactgttgtctgcgttctcttctctg
gagggcatcattaatgcatcaaaagaagagctggtgctgtgtcctggactcggtcctcag
aaggcaaaaagactgcatgatgttcttcaccagccgtttctgaagtccaaaaagaaagac
agctga

DBGET integrated database retrieval system