KEGG   Astyanax mexicanus (Mexican tetra): 103041218Help
Entry
103041218         CDS       T05042                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103041218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core Trs65
Motif
Other DBs
NCBI-GeneID: 103041218
NCBI-ProteinID: XP_007237893
Ensembl: ENSAMXG00000005859
UniProt: W5KER5
LinkDB All DBs
Position
16
AA seq 785 aa AA seqDB search
MEDQEFCELLETPEATETPAATATPAATAAPAATAAPAATATPAGPAATPAGPAATPAGP
AARPRQVSHRGRSVALAATSNKVDEQIPEFEPFMLLPRGPPPLNEYLDIWDVDMVKQPHE
VNKQRHHTNLYANDYLIVRRAQQFQIKITFNRPYKPKEDKFALEFVMGASPQYSKGTYIP
VFPTEERQSIWRGQVIETSDNVVTMGITTAPDCIVGKYGLYVAVVTPYGIRRTKRDPALD
HYIICNPWSPADSVFLDDEEQRDEYVLNELGIIYHGAYDDISERAWNYGQFEFGILDACL
FIMDKADMPLTNRGDPIKISRKASAMVNSRDDDGVLVGNWSGDYMYGVAPTSWTGSAEIL
LNYSASGGMPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNYFSAHDNDGNLKMDIILDDNG
KVDRGRTRDSIWNYHCWTECYMSRPDLPEGFGGWQVVDATPQETSDGMYRCGPASVAAIK
HGQVCYPYDAPFVFAEVNSDVVFYRRSKEGTLQPVKVNTSHVGRMVLTKAVLHDGRKDIT
DQYKFPEGTPEERRVLEKAEEFGCQREKASVPEADVDVEISAQEVQLGDDFQLELVFTNR
SSQRRVVDAYISGTVVYYTGVPSAEVVFQTPTVELDPQQSKKEKVLVRSKDYQSKLVGQG
NLHFITTGKVKETSQIITAMRLIIVHNPKLTVQVTGPPKVSEEMYVTVEFTNPFKFSLEN
VYVRLEGPGILSINTKMYRIIAPGSSITWTEHFSPRRAGPTKLMASLDCSALRQVYGEVE
VTIQP
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccaggagttttgtgagcttttagagacacctgaagcgactgaaacacctgcc
gcaactgcaactcctgcagcaactgcagctcctgcagcaactgcagctcctgcagcaact
gcaactcctgcaggaccagctgcaactcctgcaggaccagctgcaactcctgcaggacca
gctgcacgtcctcgacaggtgtcccaccgcggccgcagtgtggctcttgcagccacctct
aacaaggttgatgagcagatcccagagtttgagccctttatgctcctgcctagaggtcct
ccacctcttaatgagtatctggatatctgggacgtcgacatggtcaagcagcctcatgag
gtgaacaagcagaggcaccacactaacctgtacgccaatgactatctgattgtgcgccga
gcccagcagttccagatcaagatcacctttaaccggccctacaaacctaaagaggacaag
tttgccttggagtttgttatgggtgccagcccccagtacagtaaaggaacctacattccc
gtcttccccactgaggagcggcagagcatatggcgtggtcaagtgatcgaaacctctgac
aatgttgtcaccatgggcatcacaacagctcctgactgcattgtgggaaagtatgggctg
tatgttgctgtggtcactccgtatggcattcgcaggacaaagagggacccagccttggac
cattatatcatctgcaacccctggtccccagctgacagtgtgttcctcgatgatgaggag
cagagggatgagtatgtgctgaatgagttgggcatcatctatcatggtgcatatgatgac
atttctgagcgtgcctggaactatggacagtttgagtttggcattctggatgcctgtctg
ttcataatggataaagctgacatgcccctcaccaaccgaggagatcctatcaagatcagc
aggaaagcctctgctatggtgaactcgcgtgatgatgatggggtgttggtggggaactgg
agtggtgattatatgtatggtgtggctcctacctcctggaccggcagtgcagagatcctc
ctgaattactctgccagtggaggaatgcctgtgtgctatgcacagtgctgggtctatgca
gccgtcttcaacacctttttgcgctgcctgggcatccctagcagagttgtgaccaactat
ttctctgctcacgacaacgatggaaacctgaagatggacatcatattggacgacaacggc
aaagtggacaggggccgcaccagggactccatctggaattaccactgctggactgagtgc
tacatgtccaggccggacctgcctgagggctttggaggctggcaggttgtggatgctact
ccccaggagaccagtgatggtatgtacaggtgtggacctgcatctgtggcagccatcaaa
cacggccaggtctgctacccttatgatgccccatttgtttttgctgaggtgaacagtgat
gtggtgttctaccgcagaagtaaagagggaacactgcaaccagtgaaggtgaacaccagc
cacgtgggccgcatggtgctgaccaaagcagtgctgcacgatggacgtaaagatatcact
gaccagtacaagttcccagaagggaccccagaagagcgcagggtgctggagaaggccgag
gagtttggctgccagcgggagaaggcctctgttcccgaggcagatgtggatgtggagatt
tctgctcaggaggtgcagctgggggatgattttcagctggagctggtgttcaccaaccgc
agcagccagcggcgcgtggtggatgcctacatcagcggtacagtggtctattacacaggg
gtgccaagcgctgaggtcgtgttccagacacccaccgtggaactggatccacaacaaagt
aagaaggagaaggtgctggtgcgcagcaaggactatcagagtaagctggtggggcagggg
aacctgcacttcatcactacaggcaaagtgaaagagactagtcagatcatcaccgccatg
agactcatcatcgtgcacaatcccaagctcactgtgcaggtgactggacctcctaaagta
agtgaggagatgtatgtgacagtggagttcaccaacccctttaaattcagcctggaaaat
gtgtatgttcgtctagaagggcctggaatcctgtcaattaatacaaagatgtacaggata
atagccccaggcagctctataacatggacggagcatttcagtcctcggagagcaggcccc
accaagctgatggccagtctggactgttctgctctcaggcaggtgtatggggaggtcgag
gtcaccatccagccatga

DBGET integrated database retrieval system