KEGG   Astyanax mexicanus (Mexican tetra): 103041474
Entry
103041474         CDS       T05042                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04020  Calcium signaling pathway
amex04260  Cardiac muscle contraction
amex04261  Adrenergic signaling in cardiomyocytes
amex04270  Vascular smooth muscle contraction
amex04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103041474
   04020 Calcium signaling pathway
    103041474
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103041474
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103041474
   04261 Adrenergic signaling in cardiomyocytes
    103041474
   04270 Vascular smooth muscle contraction
    103041474
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:amex04040]
    103041474
Ion channels [BR:amex04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103041474
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C DUF4834
Other DBs
NCBI-GeneID: 103041474
NCBI-ProteinID: XP_022527438
LinkDB
Position
7
AA seq 1793 aa
MGNAGAPISTVSSTQRKRQHYSKPKKPVTTAATRPPRALLCLTLKNPIRRACINIVEWKP
FEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLC
HPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTPIGGKAAGFDVKALRAFRVLRPL
RLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFNYKDGH
KGTIAEEKPAPCAPNSAHGRHCTPHNSTQCLMGWEGPNDGITNFDNFAFAMLTVFQCITM
EGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQ
KLREKQQLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSIPASENESVNTDNAPAG
DMEGETCCTRLANRISKSKFSRYSRRWNRLCRRKCRAAVKSNVFYWLVIFLVFLNTLTIA
SEHHQQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDGFVVCGGILE
TILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFI
IIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSF
PGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARMTSP
EKRQDNEKPPIEEEKREEKIELKSITSDGETPTTTKINIDDYTGDENEEKNPYPVNDFPG
EEDDEEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSHTNKFRVLCHKIVNHNIFTN
LILFFILLSSISLAAEDPVKSDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSF
CRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFV
AIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTHTECRGTYILYKDGNVGKP
ERAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISI
FFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIP
KNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSPSFNKAMNILNMLFTGLFTV
EMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADPSSSTPSSVVRPMGLQN
TEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAV
IGMQVFGKIALRDNTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSE
EGPTTEECGSHFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKR
IWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFN
ATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFY
ATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAISGDLTVEEEL
EKAMKETVCAASEDDIFRRSGGLFGNHVNYYHQSDGRASFPQSFTTQRPLHISKSGSPGE
GESPSHEKLVDSTFTPSSYSSSGSNANINNANNTAIGHYPSPSISTVDGHTRPLLAPVLL
PHSSWCFPNQSSDSSDSCLPIIRREEESADETYDEMFKERECHPEQNMLSTEM
NT seq 5382 nt   +upstreamnt  +downstreamnt
atgggcaacgccggagcacccatctccaccgtcagctccacccaacgcaagcggcagcac
tacagcaagcccaagaaacccgtcaccaccgcggctacccgccccccgcgagccctgctc
tgcctaaccctcaaaaaccccatccgcagagcctgcatcaacatagtggagtggaaaccc
tttgaaatcatcattttgatgactatttttgctaactgcgtggccttagctgtctacatc
cccttcccagaggacgactccaacgccaccaactccaacctggagcgagtggaatatctc
ttcctcatcatctttacagtggaggcgtttctgaaggtgattgcttacgggctgctgtgc
caccccaacgcgtacctgaggaatggctggaatctgctggacttcatcatcgtggttgtg
gggttgttcagcgctatattagaacaggccactaaaggggatggagggacgccgattgga
ggaaaggcagccgggttcgatgtgaaagccctgcgagcgttcagagtattaagacctcta
agactggtgtctggagttcctagtttacaagtagtgctgaactccataattaaagccatg
gttcccctgctgcacatcgccctgctcgtactcttcgtcatcatcatctacgccatcatc
ggcctcgagctcttcatggggaagatgcaccgcacatgttttaactacaaagacggacac
aaaggtactatagctgaggagaaacctgcaccctgtgccccaaactccgcccacgggcgc
cactgcacccctcacaacagcacacaatgcctgatgggatgggagggcccaaacgacggc
atcacgaactttgataactttgcgttcgccatgctgacggtgtttcagtgcatcaccatg
gagggctggactgatgtgctgtactggatgcaggatgctatgggctatgagcttccctgg
gtctattttgtcagtctcgtcatctttggatcctttttcgttctaaatctggttctggga
gtgttgagcggagagttctctaaggagcgtgagaaggccaaggcgcgtggagatttccag
aagctgcgtgagaagcagcagctggaggaggatctgaagggctacctggactggatcacg
caagccgaggacatcgacccggagaacgatgatgagggactggatgatgacaaacctaga
aacctgagtattccagccagtgagaacgagtcagtgaacactgataacgctcctgctgga
gatatggagggagaaacctgctgtactcgtctagcaaataggatctccaaatccaaattc
agtcgctattcacgccgctggaatcgtctctgccggcggaaatgtcgagccgcagtcaag
tcgaacgtgttttactggctggtgatttttttagtgtttctgaacaccctcaccatcgcc
tctgagcaccatcaacaaccacagtggctcaccgacgtgcaagatatcgccaacaaggtc
ctgctggctctcttcaccggcgagatgcttctgaagatgtacagtttgggcctccaggcg
tattttgtctcactcttcaaccgctttgatggctttgtggtgtgcggtgggatcctggag
actattctggtggagactaagatcatgtcgcctctgggcatctcagtgctgcgctgtgtg
cgcttgctacgcatctttaaaatcaccagatactggaattctctcagcaacctggtggca
tctttgctaaactccgtccgctccatcgcctccctgctgctcctgctcttcctcttcatc
atcatcttcagcttgctgggcatgcagctcttcggtgggaagttcaacttcgatgagacc
cgtcgtagcaccttcgacaacttcccccagtctttactcacagtctttcagattttaacc
ggtgaggactggaactcagtgatgtatgatgggatcatggcttacggtgggccgtcgttt
cctgggatgcttgtgtgcatttacttcatcattctcttcatttgtggaaactacatcctc
ctgaatgtcttcttggccatcgctgtggacaacttagcagatgcagagagtctaacatca
gctcagaaagaggaagaggaggagaaggagaggaagaaactggccagaatgacgagtcca
gagaagcgacaagacaatgagaaaccaccgatagaggaggagaaacgagaggagaagatc
gagctaaaatcaatcacctcagatggagaaactccaactaccaccaagattaacattgat
gactacactggtgatgagaatgaggagaagaatccatatccagtgaatgatttcccaggg
gaggaggatgatgaagagccggagatgcccgtgggtccgagaccacgcccactttcagac
atccagctgaaggagaaagctgtgcccatgcctgaggccagagccttcttcatcttcagc
cacaccaacaagtttcgggttttgtgtcataagattgtcaatcacaacatcttcaccaac
ctcatcctcttcttcatcctgctgagcagcatctctctggctgcagaggacccagtgaag
agcgactcattcagaaaccagattctaggctatgcagatcacgtgtttacaggtctcttc
accatagagatcatattaaagatgacagcgtatggagcgttcctccataagggttctttc
tgtcgtaactactttaatattctggatctggtggtggtcagtgtctctctcatctcctca
gggattcagtcgagtgccattaatgtagtgaagattttgagagttctcagagtcctcaga
cccctgagggccatcaacagagccaagggcctcaaacatgtagttcagtgtgtgtttgtg
gctattcgcaccatcgggaacatcgtcatcgtcaccaccctgctgcagttcatgtttgcg
tgtattggagtgcaactctttaagggcaaattcttctactgcacagactcttccaaacag
acgcatacagaatgcagggggacgtatatactatataaagacggtaacgttgggaagccg
gagagagctcagagaagctgggagaacagtgacttcaatttcgatgatgttttacaagga
atgatggctttatttgctgtgtccacttttgagggatggccagggctactgtacagagca
attgactcccatgctgaagacgttggccccatctacaactaccgagtggtcatctccatc
ttcttcatcatctacatcatcatcatcgcctttttcatgatgaacatcttcgtaggtttc
gtcatcgtcaccttccaggagcaaggagagcaagagtacaagaactgcgagctggacaag
aaccagcggcagtgtgtagagtacgccctgaaggcgcggccgctgcgcaggtacattcct
aaaaacccgtatcagtataaggtgtggtacgtggttaactccacctactttgagtacctg
atgttcaccctgatcctcctcaacaccatctgcctggcaatgcagcaccatggtcagtcc
ccgtccttcaacaaagccatgaacatcctcaacatgctcttcaccggtcttttcactgtg
gagatgatcctcaaactcattgccttcaagcccaggggttactttagtgacccgtggaat
gtttttgacttcctcatcgtaattggcagcattatagacgtcattctgagtgaaataaac
ccagctgacccgtcctcctccaccccctcctctgtggtaagaccaatggggctccagaac
acggaagataatgccagaatctccatcaccttcttccggctctttcgcgtgatgagactg
gttaagctgctatctcgcggagagggaatccggactcttctgtggaccttcatcaaatcc
ttccaagctcttccatatgtagcattgctcatcgtaatgctcttcttcatctacgctgtt
attggaatgcaggtgtttggtaaaatagcactgagggacaacacccagatcaaccgaaac
aacaactttcagaccttcccacaagctgtgctactgctcttcaggtgtgcgacaggtgag
gcatggcaggaaatcatgctggcctgctccccgaaccgcccgtgtgaaaagggctctgaa
gagggtcctaccacagaggagtgcggcagccacttcgccattatctacttcgtcagcttc
tacatgctctgtgcctttctgattatcaatctgtttgtggctgtcatcatggacaacttt
gactatctgacacgtgattggtcaatcctggggccgcatcacctggatgagttcaagagg
atatgggcagagtacgaccctgaagccaaggggaggataaagcatctggatgtggtgacg
ttgttgaggaggattcagccgccgctgggctttggcaaactctgtccacacagagtggcc
tgcaagcggctggtgtccatgaacatgccgctgaacagtgatggtacagtgatgttcaac
gctacactgttcgctctggtgcgcaccgccctccgcattaaaactgaaggtaatctggag
caggcgaatgaagaactgagggcgatagtaaagaaaatctggaagagaaccagcatgaag
ctgctggatcaggtcgtgcccccagctggagatgatgaggtgaccgtggggaagttctat
gccacattcctcattcaggaatacttcaggaagtttaagaaacggaaggagcagggtctg
gtggctaaagtacctccaaagactgctctctctctgcaggctggcctgcgaactctacat
gatataggtccagagatcaggagggcgatatctggggacctgactgtggaggaggagctg
gagaaggccatgaaggagacggtgtgtgcggcgtctgaagacgatatcttcaggcgatca
ggtggtctcttcggaaaccacgtgaactattaccatcagagcgacggccgtgcctccttc
ccccagtccttcaccacccagcggccgctgcacatcagcaagtcgggaagccctggagag
ggagagtcgccgtcgcacgagaaactggtggactccaccttcaccccgagcagctactcc
tcctcaggttccaacgccaacatcaacaacgccaacaacaccgccatcggacactacccc
agcccctccatcagtactgtagacggccacaccagacccctgctggcacctgtgctactg
cctcactcttcatggtgcttccctaaccagagctcggactcaagtgacagctgcctcccg
atcatccggcgggaggaggagtctgctgatgaaacgtatgatgagatgtttaaagagaga
gagtgccatcccgagcagaacatgctgtccactgaaatgtaa

DBGET integrated database retrieval system