KEGG   Astyanax mexicanus (Mexican tetra): 103041774
Entry
103041774         CDS       T05042                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04012  ErbB signaling pathway
amex04068  FoxO signaling pathway
amex04110  Cell cycle
amex04115  p53 signaling pathway
amex04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103041774
   04068 FoxO signaling pathway
    103041774
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103041774
   04115 p53 signaling pathway
    103041774
   04218 Cellular senescence
    103041774
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103041774
NCBI-ProteinID: XP_007229906
Ensembl: ENSAMXG00000017232
LinkDB
Position
7
AA seq 175 aa
MAMMSSQCDHGELDRGEEDVKPRVAAVRRNLFGPVDHQQLQQDFQRLLCMSMEVAKQRWN
FDFQSERPASGAVEWEEMRCQDVPAFYRSCVVRAGASKCRLESQTPVSSDRGALVASVAQ
EEYLELRASGAFRGAKLEKRRKLKPLGVKHRQATITDFFTVKKRRFLHQKVSSRQ
NT seq 528 nt   +upstreamnt  +downstreamnt
atggctatgatgtcatctcagtgtgatcacggggagctcgacagaggagaagaggatgta
aagccgagggttgcggccgtccggcggaacctctttggcccagtggatcaccagcagctc
cagcaggacttccagaggctgctctgcatgagcatggaggtggccaagcagcgctggaac
ttcgactttcagagcgaacggcctgcgtccggagcggtggaatgggaggagatgcgctgc
caggacgtccctgcgttttaccgcagctgtgtggtgagggcaggggcgtccaaatgcagg
ctggagtcacaaacaccggtcagcagtgacaggggggctttagtggcctccgtggcccaa
gaagagtacctggagctgagggccagtggagcattcagaggagccaagctggagaagaga
agaaagttaaagccactgggggtcaaacacagacaagccaccatcacagacttcttcact
gtaaagaagaggaggtttcttcatcagaaagtgtcttcaagacagtga

DBGET integrated database retrieval system