KEGG   Astyanax mexicanus (Mexican tetra): 103041908Help
Entry
103041908         CDS       T05042                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103041908
Enzymes [BR:amex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103041908
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103041908
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103041908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 103041908
NCBI-ProteinID: XP_022535081
Ensembl: ENSAMXG00000000181
LinkDB All DBs
Position
17
AA seq 419 aa AA seqDB search
MAEDLKACKVACLATVEELQSICREEGLVCEELGVTKNNLCDFEVEYLCNYKRIVLTLRN
TEEVQELYLVKWKGYPESMNSWEPRKNLKCTDLLSQFWEDMVRELRRLKKRTIPKKLDAS
LASHLVQRAKLRKTLKQWETHLNSLGNKKGRIFVENLVDMEGPPKNFTYINDYKVGDGIS
LTEVAVGCECTDCLNDPVEGCCAGASQHKFAYNELGQVRVRPGLPVYECNRRCRCGPECP
NRVVQKGIQYSLCIFRTDNGRGWGVRTMERIRKNTFVMEYVGEIITTEEAERRGHVYDKE
GTTYLFDLDYVDDEYTVDAAHYGNISHFVNHSCDPNLQVYNVFIENLDERLPRIAFFATR
PIKAGEELTFDYKMQMDPVDAESTRMDSNFGLTEIPGSPKKRMRIECKCGVASCRKYLF
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagatttgaaagcgtgcaaagtggcatgtcttgctactgtagaggagctgcaa
tcgatttgcagagaggaggggctcgtctgtgaagagctgggcgtcaccaaaaacaacttg
tgtgattttgaggttgaatatctttgcaactacaagcgtatcgttctcacgctccggaac
acagaggaagtacaggagttatacttggtgaaatggaaaggctatccagagtctatgaac
tcatgggagccacggaagaacctgaagtgcacagatctgctcagtcagttctgggaggac
atggtgcgagaattgcggagactcaagaaacggaccatcccgaaaaaactggacgcctcc
ctcgcctctcacctcgtccagcgggcgaagctcaggaagaccctcaaacagtgggagacg
cacctcaacagcctgggcaacaaaaagggccgcatctttgtggagaacctggtagatatg
gaaggtccgccaaagaacttcacctacattaatgactataaggtgggtgacgggatctct
ctgactgaggtggctgtgggctgcgagtgtacggactgtctgaatgatccggtggagggc
tgctgtgccggagcctcgcagcacaagtttgcgtataacgagctcgggcaggtgcgcgtt
cggccggggctgcccgtctacgagtgcaacaggaggtgccgctgcggcccggaatgcccc
aacagggtggttcagaagggcattcagtactcactatgcatttttagaacagacaatggc
agaggctggggagtacggaccatggagcgcatccgcaaaaacaccttcgtcatggaatac
gtaggagagatcatcacgacggaggaagcggagaggaggggtcacgtgtatgataaagag
ggaaccacctacctgtttgatctggattatgttgatgatgagtacacggtggacgcggct
cactatggcaacatttcacacttcgtcaatcacagctgcgacccaaacctgcaggtgtac
aacgtgttcatagagaacctggatgagaggctaccgcgcattgctttcttcgccactcgt
cccatcaaggccggagaggagcttacctttgattacaaaatgcagatggaccctgtggat
gcagagagcacgaggatggactctaatttcgggttgactgaaatccctggttctcccaag
aagcgcatgcgtattgagtgtaaatgtggagtggcatcatgtcgaaagtatctgttttag

DBGET integrated database retrieval system