KEGG   Astyanax mexicanus (Mexican tetra): 103042507
Entry
103042507         CDS       T05042                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
amex  Astyanax mexicanus (Mexican tetra)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 103042507
NCBI-ProteinID: XP_007253353
Ensembl: ENSAMXG00000015781
UniProt: W5L8T5
LinkDB
Position
13
AA seq 368 aa
MSFGEMIELKELTMLEGRIELTASAPSRTTRLERVNALRISPGKVPELINRVRIIRLLGD
SMDDPRLVDDTGEGHNFQPCSHTQPTWCDLCGDFIWGLYRQSLRCTNCRFTCHYRCRALI
KLDCNQDRASPTDQTGDIQGNIETDTNVDEVTECKKQELSLSEIQQKIKEYNAQINSNLF
MSMNKNGTYNGFIKVHLKLVRPVSVPPPRKGAASQGPANGKKGASVKRRTSFYLPKDTAK
HLHISSKTCAKEVIQALLKKFTVIDNPAKFALFERTERHEQVYLRKLSDDECPLYLRLCS
GPNEKALSLVLKENETGEVNWDAFSMPELQNFLRILQREEEEHVKQIVRRYTLARERIQQ
SLVGSNPG
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtcttttggtgagatgattgagcttaaagagctcaccatgctggagggccgcattgaa
cttactgcttctgcaccatctcggactactcgtttggagagggtcaatgcattgaggata
agcccagggaaagttcctgagctgataaaccgggtcaggatcatcagactactgggggac
tctatggatgacccaagacttgtggatgatacaggagaaggccataactttcagccctgc
agccatactcaacccacgtggtgtgacctgtgtggagacttcatctgggggttgtacaga
caaagccttcgctgtacaaactgtaggtttacctgccattaccgctgtagagctctcatt
aaactggactgcaaccaagatcgagcttcgcctactgatcagactggtgacatccagggc
aacattgaaacagacaccaatgtggatgaagtgactgaatgtaagaaacaggagttgtca
ctttcagagattcaacagaaaataaaggagtataatgcccagatcaacagcaacctcttt
atgtctatgaataaaaatggcacctacaatggtttcatcaaagttcatttgaagttggtt
cggccagtgtctgtcccacctccccgtaaaggtgctgcatcccagggtccggccaatggg
aagaagggggcgtcggtaaagagacggacgtccttttatcttcccaaagatacagccaag
catttgcacatcagctctaaaacctgtgccaaggaggtgatccaagcccttctcaaaaag
ttcacagtcatcgacaatcctgccaagtttgcactgtttgagcgcactgaacgtcatgag
caagtgtacctgcggaagctgtctgatgacgaatgtcccctgtacttgcgcctgtgttct
ggtcccaacgagaaggctctgagtctggtcctgaaagagaacgagactggagaggtcaat
tgggatgcgttctctatgccagagcttcaaaatttcctgcgcattctgcagcgagaggaa
gaggagcacgtgaagcagattgtgcggcgctacaccctcgcccgcgaacgcatccagcag
tccctggtcggctccaaccctggctga

DBGET integrated database retrieval system