KEGG   Astyanax mexicanus (Mexican tetra): 103042559
Entry
103042559         CDS       T05042                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04060  Cytokine-cytokine receptor interaction
amex04068  FoxO signaling pathway
amex04144  Endocytosis
amex04218  Cellular senescence
amex04350  TGF-beta signaling pathway
amex04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103042559
   04350 TGF-beta signaling pathway
    103042559
   04068 FoxO signaling pathway
    103042559
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103042559
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103042559
  09143 Cell growth and death
   04218 Cellular senescence
    103042559
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103042559
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103042559
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103042559
Protein kinases [BR:amex01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103042559
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 103042559
NCBI-ProteinID: XP_022519931
LinkDB
Position
Unknown
AA seq 543 aa
MERPVFSVLSWVVLVVLVEQLGAAWLPGTLRVNEKGVLLFPQLCKFCDVLPSDCNSSSTT
CQAGCDITSICESVKEVCVSVWHTDGGNVTVETLCHNPARPIYGVLLDDYNNTQCLMKQY
KGLGPDYYMCSCNNEECNENLIFIPGLETPKEPFDYFKKVLISLVAVLVLALVIIALVYL
LWINSIRQRPLKSKHPGHGSGDTRAILHDVDNSENSLNHNTELLPIQLDGVVGKGRFAEV
HRAKLTNASVGGTNVPFQMVAVKIFPGVEFASWKTEHQIFLDAELRHENVLHFLTAEERR
TENQYWLITAYHPKGNLQDYLRNHLLTWEQMHRLGSSLTRGVAHLHSDQTPCGRPKVAIA
HRDLKSTNVLVKDDLTCCLCDFGLSLRLDSTMSVDELANSGQVGTARYMAPEVLESRINL
ENIESFKQMDVYAMALVLWEIVSRCIAIGDVKEYELPFGKLRDHPCVESMKDSVIRDRER
PEIPSSWTNHPGINTLCGTIVECWDQDPEARLTAHCVSERFNDLQDLDQNSLNFSPEQKI
QND
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggagcgtccggtgttcagcgtgttgagctgggtggtgctggtggtgctggtggagcag
ctgggagcggcgtggctgccggggacgctgagggtgaatgagaaaggtgtactgcttttt
cctcagctgtgtaagttctgtgatgttttacccagtgactgtaactccagcagcaccacc
tgccaagcaggctgtgatatcacctctatctgtgaaagcgtaaaagaggtgtgtgtaagt
gtgtggcacacagatggaggaaatgtaaccgtggagacgttgtgtcataaccccgcacgg
cccatttacggtgttctgctggacgactataataacacacagtgtttaatgaagcagtat
aaaggtctggggccggattactacatgtgttcctgtaataatgaagagtgtaacgagaac
ctcatcttcataccaggcctggagacgcctaaagaaccttttgattattttaaaaaagtt
ctgatcagcctggtagcggttctggttctggccttagtgatcattgctttagtctacttg
ctgtggataaactcgatacgccagcgaccgctgaagtccaagcaccccggccacggctcc
ggcgacactcgcgccatccttcacgacgtggacaactccgaaaacagcctgaaccacaac
acggagctgctgcccatccagctggacggtgtggtgggcaaggggcggttcgccgaggtt
caccgcgctaaactcaccaatgccagcgttggcggcaccaacgtgccattccagatggtg
gcagtcaagattttcccaggcgtggaattcgcctcttggaaaacggagcaccagatcttt
ctggacgctgagctgcggcacgagaacgtgctgcacttcctcaccgcggaggaacgccgg
accgaaaatcagtactggctaattacagcttatcaccccaagggcaacctgcaggactac
ctgagaaaccacctgctgacctgggagcagatgcacaggttgggttcttcactcacccga
ggggttgctcacctgcacagtgatcagacgccctgcggccgaccgaaagtggccatcgcc
caccgggacctgaagagcaccaatgttctggtgaaggacgacctgacctgctgcctctgt
gacttcggcctcagcctcagattggacagcaccatgtccgtcgatgagctcgccaacagc
ggacaggtgggcacagccaggtatatggcgccagaggtgctggagtccagaatcaacctg
gagaacatcgagtccttcaagcagatggacgtgtacgccatggcgctggtgctgtgggag
atcgtgtccagatgtatcgccattggagatgtaaaggagtatgagctgccgttcgggaag
ctgagggatcacccgtgtgtggagagcatgaaggacagcgtgatcagagacagagaacga
cctgagatccccagcagctggaccaatcacccgggtataaatacgttgtgtggtactata
gtggagtgttgggatcaggaccccgaggctcggctcaccgctcactgtgtgtcagagcgt
tttaatgatctgcaggatctggatcagaactccctgaacttcagtccagaacagaagatc
cagaacgactga

DBGET integrated database retrieval system