KEGG   Astyanax mexicanus (Mexican tetra): 103042656
Entry
103042656         CDS       T05042                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B-like isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04012  ErbB signaling pathway
amex04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103042656
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103042656
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103042656
Transcription factors [BR:amex03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103042656
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 DinB_2 Prominin
Other DBs
NCBI-GeneID: 103042656
NCBI-ProteinID: XP_022541158
LinkDB
Position
Unknown
AA seq 786 aa
MALWIQAQQLKGDALHQMQALYGQHFPIEVRHYLAQWIESQPWDAIDVEKQQEEFKAKRL
LDTLIQELQRKAEHQMGEDGFLLKIKLGHYASQLKSAYDPCPMELVRCIKHILYTEQRLV
QEASNASSPGVGLTDGTPQKYQQINQAFEELRVMTQDTENDLRKLQHSQEYFIIQYQESL
RIQAQLSSLTSLPPAERVQRETSLQSRKATLEAWLTREANTLQKYRQDLAEKQQRTLALL
RKQQTVIVDDELIQWKRRQQLAGNGGPPEGSLDILQSWCEKLADMIWQNRQQIRRVEHLT
QQLPIPGPTEDLLKELNATVTDIISALVTSTFIIEKQPPQVLKTQTKFATTVRLLVGGKL
NVHMNPPQVKATIINEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTVLFESQFSVGGNELMFHVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFSEPGRVPFAVPDKVTWPQLCEALNMKYKSEVQSDRGLSEENLVFLAQKAFSS
SSNNPEDYRNMTMTWSQFNRESLPGRNFTFWQWFDGVIELMKKHLKSHWNDGAILGFLNK
QQAQDMLLSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPFTTKDFSIRSL
ADRISDLNHLLFLYPNQPKDEVFSRYCTPPNSKAVGDGYVKPEIKQVVKVEFSSNSDQSA
GNSSFMDHAASPTVSQQNSFPIYPTISDPMLDPEGEFDLEETMDMARQVEEFLRQPSEPQ
WSGQQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcattatggatccaggctcagcagttaaagggggatgcactgcaccagatgcaggca
ctctatggccagcattttcccatagaggtgcgacactacctggcgcagtggatcgagtct
cagccatgggatgcgatagatgtggagaaacagcaggaggagtttaaagccaagcgcttg
ctggacactctgattcaggaactgcaaaggaaagctgaacatcagatgggggaagacggg
ttcttgctaaaaattaaactgggccattacgcatcacagttaaagagtgcatatgaccct
tgtcccatggaacttgtgcgctgtatcaaacacatcctctacacagagcagagactagta
caggaagcatcaaatgcaagcagtccgggggtgggactgacggacggcacgccacagaaa
taccagcaaatcaatcaagcgttcgaggaactgagggtgatgacacaggacacagagaat
gacctgagaaagctgcagcacagccaggaatattttatcattcagtaccaggagagtctg
agaatacaggctcagttgagtagtttgacgagtttgccaccggcagagcgagtgcagagg
gagacgagcttgcagagtcgaaaagctactctagaggcgtggctaacccgagaggcaaac
accctgcagaaatacagacaggacctagcagagaaacagcagaggacgctggcgttgttg
aggaagcagcagacagtgatagtggatgatgagctgattcagtggaagaggcggcagcag
cttgctggaaacggaggacctcctgaaggatctctggacattcttcagtcctggtgtgag
aagttggcagatatgatctggcagaaccggcagcaaattcggagggttgagcacctaaca
cagcagctgcccattccaggccctacagaagacctgcttaaagaactaaacgccacagtc
acagacatcatatccgctctagtcaccagtaccttcataatagagaagcagcctccgcag
gtgttgaagacgcagacgaagtttgcaacgacggtgcgtctgctggtaggagggaaacta
aacgtccatatgaaccctcctcaggtcaaagctactatcataaacgagcagcaggccaaa
gccctgctgaagaacgagaacaccaggaatgacagtagtggagagatcctgaacaataac
tgtgtgatggagtaccaccaaaccacaggcaccctcagcgcacactttagaaacatgtct
ttaaagcgtatcaagcgctcggacaggcgtggtgccgagtcagtgactgaggagaagttt
acggttctgtttgagtctcagttcagcgtgggaggaaatgagttaatgtttcatgtcaag
acattatctctgcctgttgtggttatcgttcatggaagtcaggacaacaatgccacagca
acagtgctgtgggacaatgctttttcagagccgggtcgagttcccttcgctgttcctgat
aaggtgacgtggccgcagctgtgtgaagctctgaatatgaaatataaatcggaggtgcag
agtgatcgtgggctttcagaagaaaatctagttttccttgcccagaaagcgttcagcagc
tccagcaacaaccctgaagattaccggaacatgaccatgacctggtcccagttcaaccgg
gaaagtttaccaggtagaaattttaccttctggcagtggtttgatggggtcatagagctt
atgaagaaacatctcaagtctcactggaatgatggggcgatactgggtttcctcaataag
cagcaggcgcaggatatgctgttatccaaacctaacggcacgttcctgctgcgcttcagt
gactcggagatcggaggcatcaccatcgcatgggtggcagaaaaccccaacaaagcagga
gagcgaatggtgtggaatctgatgcccttcaccacaaaagacttctccatccgctctctg
gctgaccgcatcagtgacctgaaccacctgctgttcctttaccccaaccaacctaaagat
gaagttttctctcgctactgcaccccacccaactcgaaagctgtaggcgatggctatgtc
aaaccagagatcaagcaggtggtgaaagtggagttttcatcaaattctgatcagtccgct
ggaaactccagcttcatggaccatgctgcttcgccaactgtcagtcaacaaaacagcttt
ccaatctaccctacaatcagtgaccctatgttggaccctgagggagagtttgatctggag
gaaacgatggacatggcccggcaggtggaggagttcctgcgacagccgtccgaacctcag
tggagcgggcagcagtcgtga

DBGET integrated database retrieval system