KEGG   Astyanax mexicanus (Mexican tetra): 103043059
Entry
103043059         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducer and activator of transcription 6-like
  KO
K11225  signal transducer and activator of transcription 6
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:amex00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103043059
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amex03000]
    103043059
Transcription factors [BR:amex03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103043059
SSDB
Motif
Pfam: STAT_bind STAT_int STAT_alpha SH2 Urb2
Other DBs
NCBI-GeneID: 103043059
NCBI-ProteinID: XP_022532594
LinkDB
Position
15
AA seq 772 aa
MCIRSGDEESLALPWRCGCKISQLLPKLPNQTLNELYPDTFPIDVRHYLANWIEDQRWED
FNVDSVEQVPLAQQLLEQMLERLYDVVSHNSNVVERVKLQHISRKLSLFQSQPMHLVRMV
RDILRKERLLLSQAPMQQYQQMPSSVNGSMQPASNRDLDALVLKVLEIQTCRQEIHRLQE
ELNWEKQDSEPMQGQTEMETKLPDQVTKQNRITQLEHSYQTCAKMRVQLLQEAVHSLEQC
QAGLIQQIKSWRWQQLRSTIGLPFDDNLVPLQTWCEQLLGVNSNLRQEIMLLRRDHGAEH
FHQLEESLSRLLQTLIQSSLVVEKQPPQVIKTQSKFSSTVRYLLGEKMAPGKPFVLKAQI
ITESQARNLGQGVIPTENVGELINSTAILEHNPSSKSTCATFRNMSIKKIKRADRKGSES
VTEEKFALLFTAEIMITGCESPCNVQMITLPVVVIVHGSQENNAMATVIWDCAFSEPNRI
PFVVPERVPWSQMCEALNSKFMSEVQTNRGLDRYNLHCLAQKIFDKDVSGDLSNTPVSWG
QFNKEVLPGRNFTFWQWFEGVIDLTKKCLKAYWSEGLIFGFIGKQHLHVILQNRPSGTFX
LRFSDSEIGGITIAYVGPSENGGRKIQNIQPFTKKDLDSSGLGDRIRDINCISHVYPEMP
KDDVFKKFYTVLSPPVPDGYLPFKLTMVVEPNSTQICTPQPQPEFSPEIPLQQDQVPGPP
FPITAPLPGPTFSPYPDPTVPAMSFHNFYGEEPMRDPHDQMELEDILSSLDS
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtgtataagaagtggcgacgaggagagccttgccttgccatggcgctgtggatgcaaa
atttcccagctgcttccaaaactgcccaaccagaccctgaatgagctgtacccggataca
ttccccatagacgtcaggcactacctggctaactggatcgaggaccagagatgggaggat
tttaacgtggacagtgtggagcaggtccccctggcccagcagctgctggagcagatgctg
gaacgtctttatgatgtagtcagccacaactccaacgtggtggagagggtcaaactccag
cacattagcaggaagctgagcttgttccagtcccagcctatgcatctggtgaggatggtg
agggatattctgaggaaggagagactcctgctcagtcaagcgccaatgcaacagtaccag
caaatgccgagctctgttaacggctccatgcagccggccagcaaccgcgacctggacgcc
ctggtgctgaaggtgctggagattcagacctgccgacaggaaattcaccgactccaagag
gagctaaactgggagaagcaagattctgaacccatgcaagggcagactgagatggagacc
aaacttccggatcaagtcaccaaacagaatcgcataacacagctggagcacagctatcaa
acctgtgccaagatgcgtgtgcaactgctgcaggaagcagtgcatagtctggaacagtgc
caagctggactcatccagcaaataaagtcttggaggtggcagcagctccgctccaccatt
ggccttcccttcgacgacaacctggtgcctctgcagacatggtgtgagcagttgctgggg
gtgaacagtaatctgagacaggaaataatgttgttgaggagggaccatggtgctgaacac
ttccaccagctggaggagagcctcagtcgtctcctgcagacactcatccagagttcactg
gtggtggagaagcagcccccacaggtgattaagacacagtccaagttctccagcacagtg
cgctacctgctgggggagaaaatggctccaggaaagccattcgtcctgaaggcccagatc
atcactgagtcacaggccaggaatttaggacagggggtgatacccactgagaacgtgggg
gagctgatcaatagcacggccatcttagaacacaacccttccagcaagagcacgtgtgct
actttcaggaatatgtccataaagaaaatcaagcgagccgacaggaagggctctgagtca
gtaacggaggagaagtttgccctgcttttcaccgcagagataatgatcacaggctgtgag
agcccctgcaatgtccagatgatcacgctccctgtggttgtaatcgtacatggaagtcag
gagaacaacgctatggctacagtcatttgggactgtgcattctccgaacctaataggatc
ccgttcgtggtaccggaacgcgttccgtggagccagatgtgtgaggctttgaacagtaag
tttatgtctgaggtgcagaccaaccgaggtttggatagatacaacctacactgcctcgct
cagaaaatcttcgacaaagatgtctcaggagacctcagcaacacgccggtatcttggggc
cagtttaacaaggaagttctgcctggacgaaatttcaccttctggcagtggtttgaggga
gtgattgacctgaccaagaaatgtctgaaggcttactggagtgaagggttgatctttggc
ttcattgggaagcagcacctccatgttattttacaaaacagaccaagtggcactttcntg
ctgcgcttcagcgactcggaaataggaggcatcaccatcgcctatgtggggcccagtgag
aatggaggcaggaaaattcagaacatccagcctttcaccaaaaaggacctggactcctcc
ggccttggcgaccgtatccgggacatcaactgcatcagtcatgtgtatccagaaatgcca
aaggatgacgtgtttaagaagttttatacagttctgtctccgccagtccctgatggatac
ctgccattcaaactcaccatggtagtggaacccaattccacccagatatgcacgccacag
ccgcagcctgaattctccccagaaatccctctgcaacaggatcaagtcccaggccctcca
ttcccaattactgctcctcttcctggacccacgttttccccatatcctgatcccaccgtg
ccggcaatgtccttccataatttctatggagaggaacccatgagagatccacatgaccaa
atggagctggaggacattctgtcatcattagacagctaa

DBGET integrated database retrieval system